Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339223.1 | 3prime_partial | 207 | 42-662(+) |
Amino Acid sequence : | |||
MYLLLVPLLAISSLHLSALTADDLTLLWDQLKFNLVSVVVCSTLMVFLGTLYFMTRPRKVYLVDFACYKAAPEVMCSKELFMERSRQAGIFTDENLEFQKKILERSGLGQKTYFPEALLR VPANPCMTEARKEAEMVMFGAIDELLAKTGVKAKDIGILVVNCSLFNPTPSLSAMVVNHYKLRGNILSYNLGGMGCSAGLISIDLAK | |||
Physicochemical properties | |||
Number of amino acids: | 207 | ||
Molecular weight: | 15,279.439 | ||
Theoretical pI: | 5.769 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 48.723 | ||
aromaticity | 0.013 | ||
GRAVY | -0.343 | ||
Secondary Structure Fraction | |||
Helix | 0.213 | ||
turn | 0.368 | ||
sheet | 0.277 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339223.1 | 5prime_partial | 188 | 662-96(-) |
Amino Acid sequence : | |||
LSKINGDQASAAAHAPKIIAQNIPPQLIMIDHHRRKRGRGIKQAAIHHQNPNIFGLHPGLGKQLINGPEHHHLGLLPGLRHAGIGRHPQQRLRKVGFLPQPRPLQNLLLKLEILVGEDPG LARPLHEQLLAAHHLRRRLVAGEVHQVHLPRPRHEVERAQEHHQRGAHHHRDQVEFQLVPQKRQIVRR* | |||
Physicochemical properties | |||
Number of amino acids: | 188 | ||
Molecular weight: | 15,279.439 | ||
Theoretical pI: | 5.769 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 48.723 | ||
aromaticity | 0.013 | ||
GRAVY | -0.343 | ||
Secondary Structure Fraction | |||
Helix | 0.213 | ||
turn | 0.368 | ||
sheet | 0.277 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339223.1 | 5prime_partial | 155 | 2-469(+) |
Amino Acid sequence : | |||
HHLAGLPLRHLPRHVSSFSSTTGHLLPPSVGVNGGRFDASVGPAEIQPGLGGGVLHADGVPGHALLHDAAAEGVPGGLRLLQGGAGGDVQQGAVHGAVAPGRDLHRRESRVSEEDSGEVG AGAENLLSGGAAEGAGQSLHDGGQEGGRDGDVRGH* | |||
Physicochemical properties | |||
Number of amino acids: | 155 | ||
Molecular weight: | 15,279.439 | ||
Theoretical pI: | 5.769 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 48.723 | ||
aromaticity | 0.013 | ||
GRAVY | -0.343 | ||
Secondary Structure Fraction | |||
Helix | 0.213 | ||
turn | 0.368 | ||
sheet | 0.277 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339223.1 | 3prime_partial | 207 | 42-662(+) |
Amino Acid sequence : | |||
MYLLLVPLLAISSLHLSALTADDLTLLWDQLKFNLVSVVVCSTLMVFLGTLYFMTRPRKVYLVDFACYKAAPEVMCSKELFMERSRQAGIFTDENLEFQKKILERSGLGQKTYFPEALLR VPANPCMTEARKEAEMVMFGAIDELLAKTGVKAKDIGILVVNCSLFNPTPSLSAMVVNHYKLRGNILSYNLGGMGCSAGLISIDLAK | |||
Physicochemical properties | |||
Number of amino acids: | 207 | ||
Molecular weight: | 15,279.439 | ||
Theoretical pI: | 5.769 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 48.723 | ||
aromaticity | 0.013 | ||
GRAVY | -0.343 | ||
Secondary Structure Fraction | |||
Helix | 0.213 | ||
turn | 0.368 | ||
sheet | 0.277 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339223.1 | 5prime_partial | 188 | 662-96(-) |
Amino Acid sequence : | |||
LSKINGDQASAAAHAPKIIAQNIPPQLIMIDHHRRKRGRGIKQAAIHHQNPNIFGLHPGLGKQLINGPEHHHLGLLPGLRHAGIGRHPQQRLRKVGFLPQPRPLQNLLLKLEILVGEDPG LARPLHEQLLAAHHLRRRLVAGEVHQVHLPRPRHEVERAQEHHQRGAHHHRDQVEFQLVPQKRQIVRR* | |||
Physicochemical properties | |||
Number of amino acids: | 188 | ||
Molecular weight: | 15,279.439 | ||
Theoretical pI: | 5.769 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 48.723 | ||
aromaticity | 0.013 | ||
GRAVY | -0.343 | ||
Secondary Structure Fraction | |||
Helix | 0.213 | ||
turn | 0.368 | ||
sheet | 0.277 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339223.1 | 5prime_partial | 155 | 2-469(+) |
Amino Acid sequence : | |||
HHLAGLPLRHLPRHVSSFSSTTGHLLPPSVGVNGGRFDASVGPAEIQPGLGGGVLHADGVPGHALLHDAAAEGVPGGLRLLQGGAGGDVQQGAVHGAVAPGRDLHRRESRVSEEDSGEVG AGAENLLSGGAAEGAGQSLHDGGQEGGRDGDVRGH* | |||
Physicochemical properties | |||
Number of amino acids: | 155 | ||
Molecular weight: | 15,279.439 | ||
Theoretical pI: | 5.769 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 48.723 | ||
aromaticity | 0.013 | ||
GRAVY | -0.343 | ||
Secondary Structure Fraction | |||
Helix | 0.213 | ||
turn | 0.368 | ||
sheet | 0.277 |