| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339232.1 | complete | 152 | 251-709(+) |
Amino Acid sequence : | |||
| MALLSQIYSLDNPIFTAYVFYTSILLLKMLFMAVIIGNQRFKKKIFISEEDSKLTRGAKIKHDDPDIERCRTGHQNDLENIPAFVIAGALYQLTGPNAWIAINLFRIGTIARIVHTFVYT VVVVPQPATAIAFFVCYGATMYMLLQTILDGL* | |||
Physicochemical properties | |||
| Number of amino acids: | 152 | ||
| Molecular weight: | 17,122.028 | ||
| Theoretical pI: | 8.565 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 16055 | ||
| Instability index: | 32.270 | ||
| aromaticity | 0.118 | ||
| GRAVY | 0.478 | ||
Secondary Structure Fraction | |||
| Helix | 0.408 | ||
| turn | 0.164 | ||
| sheet | 0.257 | ||