| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339237.1 | internal | 259 | 2-778(+) |
Amino Acid sequence : | |||
| HPLKFNSERSRLAQTFDYNYGDFIPFLRPFLKGYLAKCRDLQSRRLAFFNNYYVDKRRKIMAENGEKHKISCAIDHIIDAQMKGEISEANVLYIVENINVAAIETTLWSMEWAIAELANH PTIQQKIRDEISAVLGKQSVTESNLHQLPYLQATINETLRLHSPIPLLVPHMNQEEATLGGYTIPKESKVVVNAWWLSNNPEWWKNPEEFRPERFMEEDSGTEAAVAGGKVDFRFLPFGM GRRSCPGDNSGAAHPXPNH | |||
Physicochemical properties | |||
| Number of amino acids: | 259 | ||
| Molecular weight: | 29,525.150 | ||
| Theoretical pI: | 6.338 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 44920 45045 | ||
| Instability index: | 55.125 | ||
| aromaticity | 0.101 | ||
| GRAVY | -0.490 | ||
Secondary Structure Fraction | |||
| Helix | 0.295 | ||
| turn | 0.244 | ||
| sheet | 0.271 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339237.1 | internal | 259 | 2-778(+) |
Amino Acid sequence : | |||
| HPLKFNSERSRLAQTFDYNYGDFIPFLRPFLKGYLAKCRDLQSRRLAFFNNYYVDKRRKIMAENGEKHKISCAIDHIIDAQMKGEISEANVLYIVENINVAAIETTLWSMEWAIAELANH PTIQQKIRDEISAVLGKQSVTESNLHQLPYLQATINETLRLHSPIPLLVPHMNQEEATLGGYTIPKESKVVVNAWWLSNNPEWWKNPEEFRPERFMEEDSGTEAAVAGGKVDFRFLPFGM GRRSCPGDNSGAAHPXPNH | |||
Physicochemical properties | |||
| Number of amino acids: | 259 | ||
| Molecular weight: | 29,525.150 | ||
| Theoretical pI: | 6.338 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 44920 45045 | ||
| Instability index: | 55.125 | ||
| aromaticity | 0.101 | ||
| GRAVY | -0.490 | ||
Secondary Structure Fraction | |||
| Helix | 0.295 | ||
| turn | 0.244 | ||
| sheet | 0.271 | ||