| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339239.1 | 5prime_partial | 210 | 2-634(+) |
Amino Acid sequence : | |||
| HPVSGETRDSCSDSLLDESESEKQSRWDRCSSEEGLSEHDSFWHPNGRLRNLYFQYFEKSSPYGRVPLVDKISSLAQRHPGLMSLRSVDLSPASWMAVAWYPIYHIPEGKTVKDMQTSFL TYHTLSSSFQDMDLEEDGENVKRKRKETEGISLTPFGLATYKLQGDVWASDKMGRDRERLLSMVSVADSWLKQLQVQHHDFNYFMGARFG* | |||
Physicochemical properties | |||
| Number of amino acids: | 210 | ||
| Molecular weight: | 24,208.719 | ||
| Theoretical pI: | 5.758 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 44920 45045 | ||
| Instability index: | 59.040 | ||
| aromaticity | 0.110 | ||
| GRAVY | -0.718 | ||
Secondary Structure Fraction | |||
| Helix | 0.276 | ||
| turn | 0.257 | ||
| sheet | 0.238 | ||