Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339239.1 | 5prime_partial | 210 | 2-634(+) |
Amino Acid sequence : | |||
HPVSGETRDSCSDSLLDESESEKQSRWDRCSSEEGLSEHDSFWHPNGRLRNLYFQYFEKSSPYGRVPLVDKISSLAQRHPGLMSLRSVDLSPASWMAVAWYPIYHIPEGKTVKDMQTSFL TYHTLSSSFQDMDLEEDGENVKRKRKETEGISLTPFGLATYKLQGDVWASDKMGRDRERLLSMVSVADSWLKQLQVQHHDFNYFMGARFG* | |||
Physicochemical properties | |||
Number of amino acids: | 210 | ||
Molecular weight: | 24,208.719 | ||
Theoretical pI: | 5.758 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 44920 45045 | ||
Instability index: | 59.040 | ||
aromaticity | 0.110 | ||
GRAVY | -0.718 | ||
Secondary Structure Fraction | |||
Helix | 0.276 | ||
turn | 0.257 | ||
sheet | 0.238 |