| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339241.1 | 5prime_partial | 192 | 1-579(+) |
Amino Acid sequence : | |||
| KVFHYGSISLIVEPCRAAHMKAMEVAKEAGALLSYDPNLRLPLWPSAEEAKKQIKSIWDSADVIKVSDVELEFLTGSNKIDDESAMSLWHPNLKLLLVTLGEKGCNYYTKKFHGTVGGFH VKTVDTTGAGDSFVGALLTKIVDDQTILEDEARLKEVLRFSCACGAITTTKKGAIPALPTASEALTLLKGGA* | |||
Physicochemical properties | |||
| Number of amino acids: | 192 | ||
| Molecular weight: | 20,720.690 | ||
| Theoretical pI: | 6.237 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22710 | ||
| Instability index: | 24.744 | ||
| aromaticity | 0.068 | ||
| GRAVY | 0.005 | ||
Secondary Structure Fraction | |||
| Helix | 0.307 | ||
| turn | 0.203 | ||
| sheet | 0.307 | ||