Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339241.1 | 5prime_partial | 192 | 1-579(+) |
Amino Acid sequence : | |||
KVFHYGSISLIVEPCRAAHMKAMEVAKEAGALLSYDPNLRLPLWPSAEEAKKQIKSIWDSADVIKVSDVELEFLTGSNKIDDESAMSLWHPNLKLLLVTLGEKGCNYYTKKFHGTVGGFH VKTVDTTGAGDSFVGALLTKIVDDQTILEDEARLKEVLRFSCACGAITTTKKGAIPALPTASEALTLLKGGA* | |||
Physicochemical properties | |||
Number of amino acids: | 192 | ||
Molecular weight: | 20,720.690 | ||
Theoretical pI: | 6.237 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22710 | ||
Instability index: | 24.744 | ||
aromaticity | 0.068 | ||
GRAVY | 0.005 | ||
Secondary Structure Fraction | |||
Helix | 0.307 | ||
turn | 0.203 | ||
sheet | 0.307 |