| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339249.1 | 5prime_partial | 154 | 606-142(-) |
Amino Acid sequence : | |||
| ARGQDMAVQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGE KLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK* | |||
Physicochemical properties | |||
| Number of amino acids: | 154 | ||
| Molecular weight: | 17,359.074 | ||
| Theoretical pI: | 4.162 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 25.302 | ||
| aromaticity | 0.065 | ||
| GRAVY | -0.615 | ||
Secondary Structure Fraction | |||
| Helix | 0.240 | ||
| turn | 0.162 | ||
| sheet | 0.325 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339249.1 | 5prime_partial | 154 | 606-142(-) |
Amino Acid sequence : | |||
| ARGQDMAVQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGE KLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK* | |||
Physicochemical properties | |||
| Number of amino acids: | 154 | ||
| Molecular weight: | 17,359.074 | ||
| Theoretical pI: | 4.162 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 25.302 | ||
| aromaticity | 0.065 | ||
| GRAVY | -0.615 | ||
Secondary Structure Fraction | |||
| Helix | 0.240 | ||
| turn | 0.162 | ||
| sheet | 0.325 | ||