| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339250.1 | 5prime_partial | 170 | 703-191(-) |
Amino Acid sequence : | |||
| QDRPQLEATTEAEDQVEAGLLLDVVVSKGPSILQLLPSKDQPLLVRWDSFLILNLSLHIVYCIRTLHLQCDGLPRQCLHKYLHSSSQPQHQVQSRLLLDVVIRQCTPIFQLLPSEDQPLL IRWNTLLVLNLGLHIVNCVRALNFQSDGFSCQGLHENLHTTTEPQDQVQG* | |||
Physicochemical properties | |||
| Number of amino acids: | 170 | ||
| Molecular weight: | 17,186.527 | ||
| Theoretical pI: | 7.942 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 32.710 | ||
| aromaticity | 0.046 | ||
| GRAVY | -0.422 | ||
Secondary Structure Fraction | |||
| Helix | 0.307 | ||
| turn | 0.176 | ||
| sheet | 0.235 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339250.1 | complete | 153 | 227-688(+) |
Amino Acid sequence : | |||
| MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIHNVKAKIQDKEGIPPDQQRLI FAGKQLEDGRTLADYNIQKESSLHLVLRLRGGF* | |||
Physicochemical properties | |||
| Number of amino acids: | 153 | ||
| Molecular weight: | 17,186.527 | ||
| Theoretical pI: | 7.942 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 32.710 | ||
| aromaticity | 0.046 | ||
| GRAVY | -0.422 | ||
Secondary Structure Fraction | |||
| Helix | 0.307 | ||
| turn | 0.176 | ||
| sheet | 0.235 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339250.1 | 5prime_partial | 170 | 703-191(-) |
Amino Acid sequence : | |||
| QDRPQLEATTEAEDQVEAGLLLDVVVSKGPSILQLLPSKDQPLLVRWDSFLILNLSLHIVYCIRTLHLQCDGLPRQCLHKYLHSSSQPQHQVQSRLLLDVVIRQCTPIFQLLPSEDQPLL IRWNTLLVLNLGLHIVNCVRALNFQSDGFSCQGLHENLHTTTEPQDQVQG* | |||
Physicochemical properties | |||
| Number of amino acids: | 170 | ||
| Molecular weight: | 17,186.527 | ||
| Theoretical pI: | 7.942 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 32.710 | ||
| aromaticity | 0.046 | ||
| GRAVY | -0.422 | ||
Secondary Structure Fraction | |||
| Helix | 0.307 | ||
| turn | 0.176 | ||
| sheet | 0.235 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339250.1 | complete | 153 | 227-688(+) |
Amino Acid sequence : | |||
| MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIHNVKAKIQDKEGIPPDQQRLI FAGKQLEDGRTLADYNIQKESSLHLVLRLRGGF* | |||
Physicochemical properties | |||
| Number of amino acids: | 153 | ||
| Molecular weight: | 17,186.527 | ||
| Theoretical pI: | 7.942 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 32.710 | ||
| aromaticity | 0.046 | ||
| GRAVY | -0.422 | ||
Secondary Structure Fraction | |||
| Helix | 0.307 | ||
| turn | 0.176 | ||
| sheet | 0.235 | ||