| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339265.1 | 5prime_partial | 205 | 1-618(+) |
Amino Acid sequence : | |||
| APIKSQASLFSPAISPDRVAAPWKQSIAHFSTLKPTKSASAVAHRPIRAMAEEAPAATEAPAGFTPPELDPNTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQVFEMPTGGAAIMRQG PNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNAGRTGVGQNFRSIGKNISPIEVKFTGKQVYDL* | |||
Physicochemical properties | |||
| Number of amino acids: | 205 | ||
| Molecular weight: | 22,441.491 | ||
| Theoretical pI: | 9.736 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21430 | ||
| Instability index: | 50.245 | ||
| aromaticity | 0.093 | ||
| GRAVY | -0.391 | ||
Secondary Structure Fraction | |||
| Helix | 0.268 | ||
| turn | 0.273 | ||
| sheet | 0.249 | ||