| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339273.1 | internal | 254 | 2-763(+) |
Amino Acid sequence : | |||
| HHVRIGRSLTAAESPWFNYTATKSDYILFCHNIIFLFIIFSVFPFYYLFLEHFFASSVSPYKIQPKVKLSFSDTIRCYKSVMRMFFLVVGPLQLVSYPSVKMIGIRTSLPLPSLWEIALQ LGVYFIVEDYTNYWIHRFLHCKWGYEKIHKVHHEYTAPIGFAAPYAHWVEILVLGIPSFLGPAMVPGHMITFWLWIALRQIEAIETHSGYDFPWTPTKYIPFYGGPDYHDYHHYVGGQSQ SNFASVFTYCDYIY | |||
Physicochemical properties | |||
| Number of amino acids: | 254 | ||
| Molecular weight: | 11,235.343 | ||
| Theoretical pI: | 10.771 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
| Instability index: | 65.823 | ||
| aromaticity | 0.030 | ||
| GRAVY | 0.107 | ||
Secondary Structure Fraction | |||
| Helix | 0.360 | ||
| turn | 0.250 | ||
| sheet | 0.320 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339273.1 | complete | 119 | 697-338(-) |
Amino Acid sequence : | |||
| MVIMVIWATVKWNILCRRPREVVPTVSLNSLNLPQSNPQPECNHMPRDHRGPKKRRDPKDQNLDPVSIRRCKPDWSCVLMMHLVNFLIPPLAVQKSMDPIVGVVLHNEIHTQLQCNFPQ* | |||
Physicochemical properties | |||
| Number of amino acids: | 119 | ||
| Molecular weight: | 11,235.343 | ||
| Theoretical pI: | 10.771 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
| Instability index: | 65.823 | ||
| aromaticity | 0.030 | ||
| GRAVY | 0.107 | ||
Secondary Structure Fraction | |||
| Helix | 0.360 | ||
| turn | 0.250 | ||
| sheet | 0.320 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339273.1 | 5prime_partial | 100 | 1-303(+) |
Amino Acid sequence : | |||
| APCKDRPIPHGGGVPLVQLHRHQVRLHSLLPQHHLPLHHLLRLPLLLPLSRALLRILRQPVQNPAQSEALLLRYHPLLQIGHAYVLSCCGPPSARLLPFC* | |||
Physicochemical properties | |||
| Number of amino acids: | 100 | ||
| Molecular weight: | 11,235.343 | ||
| Theoretical pI: | 10.771 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
| Instability index: | 65.823 | ||
| aromaticity | 0.030 | ||
| GRAVY | 0.107 | ||
Secondary Structure Fraction | |||
| Helix | 0.360 | ||
| turn | 0.250 | ||
| sheet | 0.320 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339273.1 | internal | 254 | 2-763(+) |
Amino Acid sequence : | |||
| HHVRIGRSLTAAESPWFNYTATKSDYILFCHNIIFLFIIFSVFPFYYLFLEHFFASSVSPYKIQPKVKLSFSDTIRCYKSVMRMFFLVVGPLQLVSYPSVKMIGIRTSLPLPSLWEIALQ LGVYFIVEDYTNYWIHRFLHCKWGYEKIHKVHHEYTAPIGFAAPYAHWVEILVLGIPSFLGPAMVPGHMITFWLWIALRQIEAIETHSGYDFPWTPTKYIPFYGGPDYHDYHHYVGGQSQ SNFASVFTYCDYIY | |||
Physicochemical properties | |||
| Number of amino acids: | 254 | ||
| Molecular weight: | 11,235.343 | ||
| Theoretical pI: | 10.771 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
| Instability index: | 65.823 | ||
| aromaticity | 0.030 | ||
| GRAVY | 0.107 | ||
Secondary Structure Fraction | |||
| Helix | 0.360 | ||
| turn | 0.250 | ||
| sheet | 0.320 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339273.1 | complete | 119 | 697-338(-) |
Amino Acid sequence : | |||
| MVIMVIWATVKWNILCRRPREVVPTVSLNSLNLPQSNPQPECNHMPRDHRGPKKRRDPKDQNLDPVSIRRCKPDWSCVLMMHLVNFLIPPLAVQKSMDPIVGVVLHNEIHTQLQCNFPQ* | |||
Physicochemical properties | |||
| Number of amino acids: | 119 | ||
| Molecular weight: | 11,235.343 | ||
| Theoretical pI: | 10.771 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
| Instability index: | 65.823 | ||
| aromaticity | 0.030 | ||
| GRAVY | 0.107 | ||
Secondary Structure Fraction | |||
| Helix | 0.360 | ||
| turn | 0.250 | ||
| sheet | 0.320 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339273.1 | 5prime_partial | 100 | 1-303(+) |
Amino Acid sequence : | |||
| APCKDRPIPHGGGVPLVQLHRHQVRLHSLLPQHHLPLHHLLRLPLLLPLSRALLRILRQPVQNPAQSEALLLRYHPLLQIGHAYVLSCCGPPSARLLPFC* | |||
Physicochemical properties | |||
| Number of amino acids: | 100 | ||
| Molecular weight: | 11,235.343 | ||
| Theoretical pI: | 10.771 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
| Instability index: | 65.823 | ||
| aromaticity | 0.030 | ||
| GRAVY | 0.107 | ||
Secondary Structure Fraction | |||
| Helix | 0.360 | ||
| turn | 0.250 | ||
| sheet | 0.320 | ||