Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339278.1 | 3prime_partial | 212 | 122-757(+) |
Amino Acid sequence : | |||
MIAGSVAGMVEHMAMFPVDTIKTQMQALGSCPIKSASVNQAVRSILKSDGASGFYRGIGAMALGAGPAHAAYFSVYEICKKSFSGGNPDNHVAHAAAGVCATVASDAVLTPMDMVKQRLQ LGSSPYKGVLDCISRVMRQDGIGAFYASYRTTVLMNAPFTAVHFTTYEAVKRGLMEVSHSPESLNDETLVVHATAGAAAGALAAALTTPLDV | |||
Physicochemical properties | |||
Number of amino acids: | 212 | ||
Molecular weight: | 13,886.859 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
Instability index: | 97.424 | ||
aromaticity | 0.025 | ||
GRAVY | -1.024 | ||
Secondary Structure Fraction | |||
Helix | 0.202 | ||
turn | 0.252 | ||
sheet | 0.227 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339278.1 | 5prime_partial | 184 | 757-203(-) |
Amino Acid sequence : | |||
DIERSGQGGSQCSSCCSSGGVDDQRLVVETLRRMRDLHQTPFHSLVGGEMHRRERCIHQHSGPVRGIKCPNPILPHHSRNAIQNPLVRTAAQLQPLLHHIHRRKHRVAGDGGANARSRVR HVVVGIASGEALLTNLVNREISCVRGPRAESHGADPAVEAAGSVGFQNRADGLIHAGGFDWAGA* | |||
Physicochemical properties | |||
Number of amino acids: | 184 | ||
Molecular weight: | 13,886.859 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
Instability index: | 97.424 | ||
aromaticity | 0.025 | ||
GRAVY | -1.024 | ||
Secondary Structure Fraction | |||
Helix | 0.202 | ||
turn | 0.252 | ||
sheet | 0.227 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339278.1 | 5prime_partial | 119 | 1-360(+) |
Amino Acid sequence : | |||
APVRCLPKISASQTHSCAAAIRLHPSNHRRRARRTPLLAIHDCRLRRRHGGAHGYVPRRHHQNPNASPRLLPNQIRQRESSRPLYSEIRRSQRLLPRDRRHGSRRGARARSLFLCLRDL* | |||
Physicochemical properties | |||
Number of amino acids: | 119 | ||
Molecular weight: | 13,886.859 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
Instability index: | 97.424 | ||
aromaticity | 0.025 | ||
GRAVY | -1.024 | ||
Secondary Structure Fraction | |||
Helix | 0.202 | ||
turn | 0.252 | ||
sheet | 0.227 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339278.1 | 3prime_partial | 212 | 122-757(+) |
Amino Acid sequence : | |||
MIAGSVAGMVEHMAMFPVDTIKTQMQALGSCPIKSASVNQAVRSILKSDGASGFYRGIGAMALGAGPAHAAYFSVYEICKKSFSGGNPDNHVAHAAAGVCATVASDAVLTPMDMVKQRLQ LGSSPYKGVLDCISRVMRQDGIGAFYASYRTTVLMNAPFTAVHFTTYEAVKRGLMEVSHSPESLNDETLVVHATAGAAAGALAAALTTPLDV | |||
Physicochemical properties | |||
Number of amino acids: | 212 | ||
Molecular weight: | 13,886.859 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
Instability index: | 97.424 | ||
aromaticity | 0.025 | ||
GRAVY | -1.024 | ||
Secondary Structure Fraction | |||
Helix | 0.202 | ||
turn | 0.252 | ||
sheet | 0.227 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339278.1 | 5prime_partial | 184 | 757-203(-) |
Amino Acid sequence : | |||
DIERSGQGGSQCSSCCSSGGVDDQRLVVETLRRMRDLHQTPFHSLVGGEMHRRERCIHQHSGPVRGIKCPNPILPHHSRNAIQNPLVRTAAQLQPLLHHIHRRKHRVAGDGGANARSRVR HVVVGIASGEALLTNLVNREISCVRGPRAESHGADPAVEAAGSVGFQNRADGLIHAGGFDWAGA* | |||
Physicochemical properties | |||
Number of amino acids: | 184 | ||
Molecular weight: | 13,886.859 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
Instability index: | 97.424 | ||
aromaticity | 0.025 | ||
GRAVY | -1.024 | ||
Secondary Structure Fraction | |||
Helix | 0.202 | ||
turn | 0.252 | ||
sheet | 0.227 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339278.1 | 5prime_partial | 119 | 1-360(+) |
Amino Acid sequence : | |||
APVRCLPKISASQTHSCAAAIRLHPSNHRRRARRTPLLAIHDCRLRRRHGGAHGYVPRRHHQNPNASPRLLPNQIRQRESSRPLYSEIRRSQRLLPRDRRHGSRRGARARSLFLCLRDL* | |||
Physicochemical properties | |||
Number of amino acids: | 119 | ||
Molecular weight: | 13,886.859 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
Instability index: | 97.424 | ||
aromaticity | 0.025 | ||
GRAVY | -1.024 | ||
Secondary Structure Fraction | |||
Helix | 0.202 | ||
turn | 0.252 | ||
sheet | 0.227 |