Acc_NO	ORF type	length	start-end position (strand +/-)
>DY339288.1	complete	174	108-632(+)
Amino Acid sequence :
MESAAVPRLFDCAVGTNSHLKSVFRRSSMATLNATLCDLTKFPACGGKNISHRRRHGSLLVSCAKSSGATITAKSKGEPNGAVQSDNQSNGSLGKKSPSTATFPSGFEALLTEVCEETEI AELNVKLGAFEILLARQSMNLLFLKQQHLLFQVNQKVNHLVLFLLHHQNLLQKK*
Physicochemical properties
Number of amino acids:		174
Molecular weight:		18,917.596
Theoretical pI:		9.508
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		0 250
Instability index:		56.968
aromaticity		0.052
GRAVY		-0.144
Secondary Structure Fraction
Helix		0.276
turn		0.259
sheet		0.299