| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339288.1 | complete | 174 | 108-632(+) |
Amino Acid sequence : | |||
| MESAAVPRLFDCAVGTNSHLKSVFRRSSMATLNATLCDLTKFPACGGKNISHRRRHGSLLVSCAKSSGATITAKSKGEPNGAVQSDNQSNGSLGKKSPSTATFPSGFEALLTEVCEETEI AELNVKLGAFEILLARQSMNLLFLKQQHLLFQVNQKVNHLVLFLLHHQNLLQKK* | |||
Physicochemical properties | |||
| Number of amino acids: | 174 | ||
| Molecular weight: | 18,917.596 | ||
| Theoretical pI: | 9.508 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 250 | ||
| Instability index: | 56.968 | ||
| aromaticity | 0.052 | ||
| GRAVY | -0.144 | ||
Secondary Structure Fraction | |||
| Helix | 0.276 | ||
| turn | 0.259 | ||
| sheet | 0.299 | ||