| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339290.1 | 3prime_partial | 132 | 398-3(-) |
Amino Acid sequence : | |||
| MLTGLTVIGDSGLKTTSGGVNDENSTISLGSTSDHVLDKVTMARGINASAVVFGGLEFPQGNINGDTTLTLGLELVKNPGVFEGPLVHVSRFLLEPLNDMLVNSSKLVDKVSSGGRLSRV DVANDHNADVSI | |||
Physicochemical properties | |||
| Number of amino acids: | 132 | ||
| Molecular weight: | 13,705.275 | ||
| Theoretical pI: | 4.786 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 17.750 | ||
| aromaticity | 0.030 | ||
| GRAVY | 0.084 | ||
Secondary Structure Fraction | |||
| Helix | 0.318 | ||
| turn | 0.333 | ||
| sheet | 0.227 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339290.1 | 3prime_partial | 132 | 398-3(-) |
Amino Acid sequence : | |||
| MLTGLTVIGDSGLKTTSGGVNDENSTISLGSTSDHVLDKVTMARGINASAVVFGGLEFPQGNINGDTTLTLGLELVKNPGVFEGPLVHVSRFLLEPLNDMLVNSSKLVDKVSSGGRLSRV DVANDHNADVSI | |||
Physicochemical properties | |||
| Number of amino acids: | 132 | ||
| Molecular weight: | 13,705.275 | ||
| Theoretical pI: | 4.786 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 17.750 | ||
| aromaticity | 0.030 | ||
| GRAVY | 0.084 | ||
Secondary Structure Fraction | |||
| Helix | 0.318 | ||
| turn | 0.333 | ||
| sheet | 0.227 | ||