Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339290.1 | 3prime_partial | 132 | 398-3(-) |
Amino Acid sequence : | |||
MLTGLTVIGDSGLKTTSGGVNDENSTISLGSTSDHVLDKVTMARGINASAVVFGGLEFPQGNINGDTTLTLGLELVKNPGVFEGPLVHVSRFLLEPLNDMLVNSSKLVDKVSSGGRLSRV DVANDHNADVSI | |||
Physicochemical properties | |||
Number of amino acids: | 132 | ||
Molecular weight: | 13,705.275 | ||
Theoretical pI: | 4.786 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 17.750 | ||
aromaticity | 0.030 | ||
GRAVY | 0.084 | ||
Secondary Structure Fraction | |||
Helix | 0.318 | ||
turn | 0.333 | ||
sheet | 0.227 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339290.1 | 3prime_partial | 132 | 398-3(-) |
Amino Acid sequence : | |||
MLTGLTVIGDSGLKTTSGGVNDENSTISLGSTSDHVLDKVTMARGINASAVVFGGLEFPQGNINGDTTLTLGLELVKNPGVFEGPLVHVSRFLLEPLNDMLVNSSKLVDKVSSGGRLSRV DVANDHNADVSI | |||
Physicochemical properties | |||
Number of amino acids: | 132 | ||
Molecular weight: | 13,705.275 | ||
Theoretical pI: | 4.786 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 17.750 | ||
aromaticity | 0.030 | ||
GRAVY | 0.084 | ||
Secondary Structure Fraction | |||
Helix | 0.318 | ||
turn | 0.333 | ||
sheet | 0.227 |