| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339295.1 | 5prime_partial | 108 | 3-329(+) |
Amino Acid sequence : | |||
| TMSDAVMLMWILHDWSDDKCIEILKKCKEAIPASTGKVMIVDAIINEDGEGDEFSGARLSLDMIMLAVMAQGKERTYKEWVHLLNEAGFSKHTVKNIKSIESVIEAYP* | |||
Physicochemical properties | |||
| Number of amino acids: | 108 | ||
| Molecular weight: | 12,130.970 | ||
| Theoretical pI: | 4.960 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19605 | ||
| Instability index: | 30.661 | ||
| aromaticity | 0.065 | ||
| GRAVY | -0.049 | ||
Secondary Structure Fraction | |||
| Helix | 0.306 | ||
| turn | 0.176 | ||
| sheet | 0.315 | ||