| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339301.1 | 3prime_partial | 149 | 449-3(-) |
Amino Acid sequence : | |||
| MPLSDKNSSMVNGLGHTRLKHESLQATLQKVLYCEGQDIIKLVLALIKEPIPVHPPQKSFTFKNTTRILLVKSQQISCIIPDSAQSILNPPKLSLTPESIFSNQLQLCIKTLLLIGAAGL LECLPIVAVKGDVHQGFWLLKPSVRSATG | |||
Physicochemical properties | |||
| Number of amino acids: | 149 | ||
| Molecular weight: | 13,112.783 | ||
| Theoretical pI: | 10.144 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 59.002 | ||
| aromaticity | 0.060 | ||
| GRAVY | -0.611 | ||
Secondary Structure Fraction | |||
| Helix | 0.284 | ||
| turn | 0.216 | ||
| sheet | 0.233 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339301.1 | complete | 116 | 288-638(+) |
Amino Acid sequence : | |||
| MNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHARVLIRQRHIRVGRQVVNVPSFLVRVDSQKHIDFSLTSPFGGGRPGRVKRRNQKAAAKKASGGDGDEDDEE* | |||
Physicochemical properties | |||
| Number of amino acids: | 116 | ||
| Molecular weight: | 13,112.783 | ||
| Theoretical pI: | 10.144 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 59.002 | ||
| aromaticity | 0.060 | ||
| GRAVY | -0.611 | ||
Secondary Structure Fraction | |||
| Helix | 0.284 | ||
| turn | 0.216 | ||
| sheet | 0.233 | ||