| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339305.1 | internal | 245 | 2-736(+) |
Amino Acid sequence : | |||
| HHLSTMANNTNAGVITCKAAVAWKPSEPLVVEEICVEPPKSTEVRIKMLAASMCHTDILLWKGFFPLYPRIPGHEGAGVIESVGEKVTNLKVGDTVMPLSIGQCGECSNCATGKTNICFK YPFGISGLMPDGTSRMSAKGQKLYHMFTCSTWSEYTVVDSNFVVKVDPRIPLPHASLLTCGFLTGYGAPWRESRVEKGSTVAVIGLGAVGLGAVSASRILGASKIIGIDVNELKREKATV FGVTE | |||
Physicochemical properties | |||
| Number of amino acids: | 245 | ||
| Molecular weight: | 12,567.508 | ||
| Theoretical pI: | 8.615 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
| Instability index: | 43.905 | ||
| aromaticity | 0.094 | ||
| GRAVY | 0.371 | ||
Secondary Structure Fraction | |||
| Helix | 0.308 | ||
| turn | 0.282 | ||
| sheet | 0.214 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339305.1 | 3prime_partial | 117 | 351-1(-) |
Amino Acid sequence : | |||
| MFVFPVAQLEHSPHCPMESGITVSPTLRFVTFSPTLSITPAPSCPGIRGYRGKKPFQSRISVWHMLAASILILTSVDLGGSTQISSTTSGSDGFHATAALHVMTPAFVLFAMVDKWC | |||
Physicochemical properties | |||
| Number of amino acids: | 117 | ||
| Molecular weight: | 12,567.508 | ||
| Theoretical pI: | 8.615 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
| Instability index: | 43.905 | ||
| aromaticity | 0.094 | ||
| GRAVY | 0.371 | ||
Secondary Structure Fraction | |||
| Helix | 0.308 | ||
| turn | 0.282 | ||
| sheet | 0.214 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339305.1 | internal | 245 | 2-736(+) |
Amino Acid sequence : | |||
| HHLSTMANNTNAGVITCKAAVAWKPSEPLVVEEICVEPPKSTEVRIKMLAASMCHTDILLWKGFFPLYPRIPGHEGAGVIESVGEKVTNLKVGDTVMPLSIGQCGECSNCATGKTNICFK YPFGISGLMPDGTSRMSAKGQKLYHMFTCSTWSEYTVVDSNFVVKVDPRIPLPHASLLTCGFLTGYGAPWRESRVEKGSTVAVIGLGAVGLGAVSASRILGASKIIGIDVNELKREKATV FGVTE | |||
Physicochemical properties | |||
| Number of amino acids: | 245 | ||
| Molecular weight: | 12,567.508 | ||
| Theoretical pI: | 8.615 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
| Instability index: | 43.905 | ||
| aromaticity | 0.094 | ||
| GRAVY | 0.371 | ||
Secondary Structure Fraction | |||
| Helix | 0.308 | ||
| turn | 0.282 | ||
| sheet | 0.214 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339305.1 | 3prime_partial | 117 | 351-1(-) |
Amino Acid sequence : | |||
| MFVFPVAQLEHSPHCPMESGITVSPTLRFVTFSPTLSITPAPSCPGIRGYRGKKPFQSRISVWHMLAASILILTSVDLGGSTQISSTTSGSDGFHATAALHVMTPAFVLFAMVDKWC | |||
Physicochemical properties | |||
| Number of amino acids: | 117 | ||
| Molecular weight: | 12,567.508 | ||
| Theoretical pI: | 8.615 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
| Instability index: | 43.905 | ||
| aromaticity | 0.094 | ||
| GRAVY | 0.371 | ||
Secondary Structure Fraction | |||
| Helix | 0.308 | ||
| turn | 0.282 | ||
| sheet | 0.214 | ||