Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339315.1 | internal | 220 | 2-661(+) |
Amino Acid sequence : | |||
CLHNSIKMALNLSLNTKQSPPIKAISTFRRPPPPCMATAVAVAGNQSYWDTIRDDINSYLKKAIPIRSPETVFEPMHHLTLSAPSTTASALCVAACELIGGHRSQAIAAASAIHLVHAAA HAHEHLPLTDGSRPECKPDIQHKFNPNIELLTGDGIAPFGFELLARSIDDPAQDQNPARILRVIIEISQAAGSQGLIDGLYKEAEIVDPLSRFGFVEYVC | |||
Physicochemical properties | |||
Number of amino acids: | 220 | ||
Molecular weight: | 16,895.068 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
Instability index: | 91.515 | ||
aromaticity | 0.014 | ||
GRAVY | -1.336 | ||
Secondary Structure Fraction | |||
Helix | 0.149 | ||
turn | 0.331 | ||
sheet | 0.176 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339315.1 | 3prime_partial | 168 | 504-1(-) |
Amino Acid sequence : | |||
MDRARSSNPNGAIPSPVRSSMLGLNLCWISGLHSGLEPSVRGRCSWAWAAACTRCMAEAAAMAWLRWPPMSSQAATQRAEAVVEGAERVRWCMGSNTVSGDLIGMAFLRYELMSSRMVSQ YDWFPATATAVAMHGGGGRRKVDIALMGGLCLVLRERFRAILIELWRQ | |||
Physicochemical properties | |||
Number of amino acids: | 168 | ||
Molecular weight: | 16,895.068 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
Instability index: | 91.515 | ||
aromaticity | 0.014 | ||
GRAVY | -1.336 | ||
Secondary Structure Fraction | |||
Helix | 0.149 | ||
turn | 0.331 | ||
sheet | 0.176 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339315.1 | 5prime_partial | 148 | 1-447(+) |
Amino Acid sequence : | |||
LPPQFNQNGSKSLSQHQTKSPHQSDINLPPSTAAVHGHRRRRRREPIILGHHPGRHQLVSQESHPNKIAGNGIRAHAPPHPLRPLHHRLRPLCGGLRAHRRPPEPSHRRRLRHTPRACGG PRPRAPPPNRRLQARMQARYPTQVQPQH* | |||
Physicochemical properties | |||
Number of amino acids: | 148 | ||
Molecular weight: | 16,895.068 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
Instability index: | 91.515 | ||
aromaticity | 0.014 | ||
GRAVY | -1.336 | ||
Secondary Structure Fraction | |||
Helix | 0.149 | ||
turn | 0.331 | ||
sheet | 0.176 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339315.1 | internal | 220 | 2-661(+) |
Amino Acid sequence : | |||
CLHNSIKMALNLSLNTKQSPPIKAISTFRRPPPPCMATAVAVAGNQSYWDTIRDDINSYLKKAIPIRSPETVFEPMHHLTLSAPSTTASALCVAACELIGGHRSQAIAAASAIHLVHAAA HAHEHLPLTDGSRPECKPDIQHKFNPNIELLTGDGIAPFGFELLARSIDDPAQDQNPARILRVIIEISQAAGSQGLIDGLYKEAEIVDPLSRFGFVEYVC | |||
Physicochemical properties | |||
Number of amino acids: | 220 | ||
Molecular weight: | 16,895.068 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
Instability index: | 91.515 | ||
aromaticity | 0.014 | ||
GRAVY | -1.336 | ||
Secondary Structure Fraction | |||
Helix | 0.149 | ||
turn | 0.331 | ||
sheet | 0.176 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339315.1 | 3prime_partial | 168 | 504-1(-) |
Amino Acid sequence : | |||
MDRARSSNPNGAIPSPVRSSMLGLNLCWISGLHSGLEPSVRGRCSWAWAAACTRCMAEAAAMAWLRWPPMSSQAATQRAEAVVEGAERVRWCMGSNTVSGDLIGMAFLRYELMSSRMVSQ YDWFPATATAVAMHGGGGRRKVDIALMGGLCLVLRERFRAILIELWRQ | |||
Physicochemical properties | |||
Number of amino acids: | 168 | ||
Molecular weight: | 16,895.068 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
Instability index: | 91.515 | ||
aromaticity | 0.014 | ||
GRAVY | -1.336 | ||
Secondary Structure Fraction | |||
Helix | 0.149 | ||
turn | 0.331 | ||
sheet | 0.176 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339315.1 | 5prime_partial | 148 | 1-447(+) |
Amino Acid sequence : | |||
LPPQFNQNGSKSLSQHQTKSPHQSDINLPPSTAAVHGHRRRRRREPIILGHHPGRHQLVSQESHPNKIAGNGIRAHAPPHPLRPLHHRLRPLCGGLRAHRRPPEPSHRRRLRHTPRACGG PRPRAPPPNRRLQARMQARYPTQVQPQH* | |||
Physicochemical properties | |||
Number of amino acids: | 148 | ||
Molecular weight: | 16,895.068 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
Instability index: | 91.515 | ||
aromaticity | 0.014 | ||
GRAVY | -1.336 | ||
Secondary Structure Fraction | |||
Helix | 0.149 | ||
turn | 0.331 | ||
sheet | 0.176 |