| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339321.1 | 3prime_partial | 206 | 70-687(+) |
Amino Acid sequence : | |||
| MTTNSGPQIWNNNNSLTVGNRGPILLEDYHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLV GNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLVNKAGKAYYV | |||
Physicochemical properties | |||
| Number of amino acids: | 206 | ||
| Molecular weight: | 21,093.791 | ||
| Theoretical pI: | 6.309 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22000 22125 | ||
| Instability index: | 50.845 | ||
| aromaticity | 0.053 | ||
| GRAVY | -0.367 | ||
Secondary Structure Fraction | |||
| Helix | 0.299 | ||
| turn | 0.257 | ||
| sheet | 0.219 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339321.1 | complete | 187 | 624-61(-) |
Amino Acid sequence : | |||
| MPVVLWDTNIIEEEGKHVQTLRMVREEVQDSPVLLNVGLRVGFQCVNHIREFHSITNKENREVVSDQVKVSLSRVELHGKSSRVPESFRATALMDNSGEPDNNRCLNTWGSKEISACKIR NIMSDLEKPLGAGTSGMDNTFWDPLAIEVSKFLHQMIIFKEDWTSVSDSQRVVVVPNLRAGIGGHKR* | |||
Physicochemical properties | |||
| Number of amino acids: | 187 | ||
| Molecular weight: | 21,093.791 | ||
| Theoretical pI: | 6.309 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22000 22125 | ||
| Instability index: | 50.845 | ||
| aromaticity | 0.053 | ||
| GRAVY | -0.367 | ||
Secondary Structure Fraction | |||
| Helix | 0.299 | ||
| turn | 0.257 | ||
| sheet | 0.219 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339321.1 | 3prime_partial | 206 | 70-687(+) |
Amino Acid sequence : | |||
| MTTNSGPQIWNNNNSLTVGNRGPILLEDYHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLV GNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLVNKAGKAYYV | |||
Physicochemical properties | |||
| Number of amino acids: | 206 | ||
| Molecular weight: | 21,093.791 | ||
| Theoretical pI: | 6.309 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22000 22125 | ||
| Instability index: | 50.845 | ||
| aromaticity | 0.053 | ||
| GRAVY | -0.367 | ||
Secondary Structure Fraction | |||
| Helix | 0.299 | ||
| turn | 0.257 | ||
| sheet | 0.219 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339321.1 | complete | 187 | 624-61(-) |
Amino Acid sequence : | |||
| MPVVLWDTNIIEEEGKHVQTLRMVREEVQDSPVLLNVGLRVGFQCVNHIREFHSITNKENREVVSDQVKVSLSRVELHGKSSRVPESFRATALMDNSGEPDNNRCLNTWGSKEISACKIR NIMSDLEKPLGAGTSGMDNTFWDPLAIEVSKFLHQMIIFKEDWTSVSDSQRVVVVPNLRAGIGGHKR* | |||
Physicochemical properties | |||
| Number of amino acids: | 187 | ||
| Molecular weight: | 21,093.791 | ||
| Theoretical pI: | 6.309 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22000 22125 | ||
| Instability index: | 50.845 | ||
| aromaticity | 0.053 | ||
| GRAVY | -0.367 | ||
Secondary Structure Fraction | |||
| Helix | 0.299 | ||
| turn | 0.257 | ||
| sheet | 0.219 | ||