| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339325.1 | 5prime_partial | 143 | 599-168(-) |
Amino Acid sequence : | |||
| LPNMVVMAPSDEAELMHMIATAAIIDDRPSCVRYPRGNGVGAPLPPNNKGTPLEIGKGRILKEGNRVAILGFGTIVQNCLAAAGVLEEHGISATVADARFCKPLDGDLIKNLGKEHEILI KKKRGLLVDSAHMFLISCPSMNF* | |||
Physicochemical properties | |||
| Number of amino acids: | 143 | ||
| Molecular weight: | 14,498.069 | ||
| Theoretical pI: | 10.229 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1740 | ||
| Instability index: | 65.253 | ||
| aromaticity | 0.081 | ||
| GRAVY | 0.331 | ||
Secondary Structure Fraction | |||
| Helix | 0.265 | ||
| turn | 0.331 | ||
| sheet | 0.279 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339325.1 | 3prime_partial | 136 | 193-600(+) |
Amino Acid sequence : | |||
| MRNMCAESTNRPLFFLIRISCSFPKFFIKSPSRGLQNLASATVADMPCSSRTPAAAKQFCTIVPNPKMATLFPSFNILPFPISNGVPLLLGGRGAPTPFPLGYLTQLGRSSMIAAVAIMC MSSASSEGAMTTMLGR | |||
Physicochemical properties | |||
| Number of amino acids: | 136 | ||
| Molecular weight: | 14,498.069 | ||
| Theoretical pI: | 10.229 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1740 | ||
| Instability index: | 65.253 | ||
| aromaticity | 0.081 | ||
| GRAVY | 0.331 | ||
Secondary Structure Fraction | |||
| Helix | 0.265 | ||
| turn | 0.331 | ||
| sheet | 0.279 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339325.1 | 5prime_partial | 143 | 599-168(-) |
Amino Acid sequence : | |||
| LPNMVVMAPSDEAELMHMIATAAIIDDRPSCVRYPRGNGVGAPLPPNNKGTPLEIGKGRILKEGNRVAILGFGTIVQNCLAAAGVLEEHGISATVADARFCKPLDGDLIKNLGKEHEILI KKKRGLLVDSAHMFLISCPSMNF* | |||
Physicochemical properties | |||
| Number of amino acids: | 143 | ||
| Molecular weight: | 14,498.069 | ||
| Theoretical pI: | 10.229 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1740 | ||
| Instability index: | 65.253 | ||
| aromaticity | 0.081 | ||
| GRAVY | 0.331 | ||
Secondary Structure Fraction | |||
| Helix | 0.265 | ||
| turn | 0.331 | ||
| sheet | 0.279 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339325.1 | 3prime_partial | 136 | 193-600(+) |
Amino Acid sequence : | |||
| MRNMCAESTNRPLFFLIRISCSFPKFFIKSPSRGLQNLASATVADMPCSSRTPAAAKQFCTIVPNPKMATLFPSFNILPFPISNGVPLLLGGRGAPTPFPLGYLTQLGRSSMIAAVAIMC MSSASSEGAMTTMLGR | |||
Physicochemical properties | |||
| Number of amino acids: | 136 | ||
| Molecular weight: | 14,498.069 | ||
| Theoretical pI: | 10.229 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1740 | ||
| Instability index: | 65.253 | ||
| aromaticity | 0.081 | ||
| GRAVY | 0.331 | ||
Secondary Structure Fraction | |||
| Helix | 0.265 | ||
| turn | 0.331 | ||
| sheet | 0.279 | ||