| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339328.1 | internal | 229 | 3-689(+) |
Amino Acid sequence : | |||
| TSTRAEFGTRRNGIVWFWPNSDPKYKDIYLTNKPHYIPELDDPSFTCTTITREVPYGYEILAENLMDPSHVPYAHYGILELEKVKESSKRDREGGHEMEISVGTIDGNGFSAKHVSADYY FVPPYVYYGRITPNAATKTKDATLPVVPEEKTAMIVFYCIPVTPGYSRLIYAGARNFAVQIDRFVPRWITHMSHNLIFDSDLFLLHVEEQKLKDLDWHKSCYIPTKADG | |||
Physicochemical properties | |||
| Number of amino acids: | 229 | ||
| Molecular weight: | 12,930.800 | ||
| Theoretical pI: | 5.877 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30480 30730 | ||
| Instability index: | 43.144 | ||
| aromaticity | 0.097 | ||
| GRAVY | -0.017 | ||
Secondary Structure Fraction | |||
| Helix | 0.363 | ||
| turn | 0.248 | ||
| sheet | 0.204 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339328.1 | 5prime_partial | 113 | 689-348(-) |
Amino Acid sequence : | |||
| PIRLCGNVATFMPVQILELLLLDMKKKEIGIKNQVVGHMSDPAWHESINLDSEIPGTSVDEPAVTRCNWDAVENNHGCFLLRNYWQRRIFSFCGGVWSNTPVVYVRWNEVVIC* | |||
Physicochemical properties | |||
| Number of amino acids: | 113 | ||
| Molecular weight: | 12,930.800 | ||
| Theoretical pI: | 5.877 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30480 30730 | ||
| Instability index: | 43.144 | ||
| aromaticity | 0.097 | ||
| GRAVY | -0.017 | ||
Secondary Structure Fraction | |||
| Helix | 0.363 | ||
| turn | 0.248 | ||
| sheet | 0.204 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339328.1 | internal | 229 | 3-689(+) |
Amino Acid sequence : | |||
| TSTRAEFGTRRNGIVWFWPNSDPKYKDIYLTNKPHYIPELDDPSFTCTTITREVPYGYEILAENLMDPSHVPYAHYGILELEKVKESSKRDREGGHEMEISVGTIDGNGFSAKHVSADYY FVPPYVYYGRITPNAATKTKDATLPVVPEEKTAMIVFYCIPVTPGYSRLIYAGARNFAVQIDRFVPRWITHMSHNLIFDSDLFLLHVEEQKLKDLDWHKSCYIPTKADG | |||
Physicochemical properties | |||
| Number of amino acids: | 229 | ||
| Molecular weight: | 12,930.800 | ||
| Theoretical pI: | 5.877 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30480 30730 | ||
| Instability index: | 43.144 | ||
| aromaticity | 0.097 | ||
| GRAVY | -0.017 | ||
Secondary Structure Fraction | |||
| Helix | 0.363 | ||
| turn | 0.248 | ||
| sheet | 0.204 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339328.1 | 5prime_partial | 113 | 689-348(-) |
Amino Acid sequence : | |||
| PIRLCGNVATFMPVQILELLLLDMKKKEIGIKNQVVGHMSDPAWHESINLDSEIPGTSVDEPAVTRCNWDAVENNHGCFLLRNYWQRRIFSFCGGVWSNTPVVYVRWNEVVIC* | |||
Physicochemical properties | |||
| Number of amino acids: | 113 | ||
| Molecular weight: | 12,930.800 | ||
| Theoretical pI: | 5.877 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30480 30730 | ||
| Instability index: | 43.144 | ||
| aromaticity | 0.097 | ||
| GRAVY | -0.017 | ||
Secondary Structure Fraction | |||
| Helix | 0.363 | ||
| turn | 0.248 | ||
| sheet | 0.204 | ||