| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339333.1 | 5prime_partial | 251 | 796-41(-) |
Amino Acid sequence : | |||
| SRFREAADVVFKVIGKPWTVPWTAETILQVMLLWIVSFWFIGSWMIPFGAYMVGISKESLTFRGQALFSLLTDVTEGLAGILILQRCLTRFRPLPSDWFKFSLKGNWLFDVVLGCLMFPL VNRLSQFNLDLLPVLPSTPLTLSSVEQSILARDPVAMALYALVLVVCAPLWEEIVFRGFLLPSLTKYMPVWCSILMSSIAFALAHFNVQRMLPLIFVGVVMGVIYGRSRNLLPSILLHSL WDGFVFLDLMK* | |||
Physicochemical properties | |||
| Number of amino acids: | 251 | ||
| Molecular weight: | 16,896.036 | ||
| Theoretical pI: | 11.053 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4720 | ||
| Instability index: | 36.993 | ||
| aromaticity | 0.047 | ||
| GRAVY | -0.866 | ||
Secondary Structure Fraction | |||
| Helix | 0.193 | ||
| turn | 0.287 | ||
| sheet | 0.193 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339333.1 | complete | 150 | 93-545(+) |
Amino Acid sequence : | |||
| MDGNKFLERPYITPITTPTKISGNILCTLKCAKAKAMELIRMEHHTGMYFVNEGRRKPLNTISSQRGAQTTRTNAYNAIATGSRANIDCSTLERVKGVEGRTGNRSRLNCDSRFTNGNMR HPRTTSNSQLPFRLNLNQSDGSGRKRVRHR* | |||
Physicochemical properties | |||
| Number of amino acids: | 150 | ||
| Molecular weight: | 16,896.036 | ||
| Theoretical pI: | 11.053 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4720 | ||
| Instability index: | 36.993 | ||
| aromaticity | 0.047 | ||
| GRAVY | -0.866 | ||
Secondary Structure Fraction | |||
| Helix | 0.193 | ||
| turn | 0.287 | ||
| sheet | 0.193 | ||