Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339333.1 | 5prime_partial | 251 | 796-41(-) |
Amino Acid sequence : | |||
SRFREAADVVFKVIGKPWTVPWTAETILQVMLLWIVSFWFIGSWMIPFGAYMVGISKESLTFRGQALFSLLTDVTEGLAGILILQRCLTRFRPLPSDWFKFSLKGNWLFDVVLGCLMFPL VNRLSQFNLDLLPVLPSTPLTLSSVEQSILARDPVAMALYALVLVVCAPLWEEIVFRGFLLPSLTKYMPVWCSILMSSIAFALAHFNVQRMLPLIFVGVVMGVIYGRSRNLLPSILLHSL WDGFVFLDLMK* | |||
Physicochemical properties | |||
Number of amino acids: | 251 | ||
Molecular weight: | 16,896.036 | ||
Theoretical pI: | 11.053 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4720 | ||
Instability index: | 36.993 | ||
aromaticity | 0.047 | ||
GRAVY | -0.866 | ||
Secondary Structure Fraction | |||
Helix | 0.193 | ||
turn | 0.287 | ||
sheet | 0.193 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339333.1 | complete | 150 | 93-545(+) |
Amino Acid sequence : | |||
MDGNKFLERPYITPITTPTKISGNILCTLKCAKAKAMELIRMEHHTGMYFVNEGRRKPLNTISSQRGAQTTRTNAYNAIATGSRANIDCSTLERVKGVEGRTGNRSRLNCDSRFTNGNMR HPRTTSNSQLPFRLNLNQSDGSGRKRVRHR* | |||
Physicochemical properties | |||
Number of amino acids: | 150 | ||
Molecular weight: | 16,896.036 | ||
Theoretical pI: | 11.053 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4720 | ||
Instability index: | 36.993 | ||
aromaticity | 0.047 | ||
GRAVY | -0.866 | ||
Secondary Structure Fraction | |||
Helix | 0.193 | ||
turn | 0.287 | ||
sheet | 0.193 |