| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339336.1 | 5prime_partial | 117 | 3-356(+) |
Amino Acid sequence : | |||
| ARGLDATEEYMRSVMDLMAIDRPNLAVARSYMVTDHTHSGLDEVDYGWGKAAYGGAATVGIHSAPGLVSFATPFKNENGEDGIVVPMSLPPDAMDLFAEELQRMLMAARKGFTASAL* | |||
Physicochemical properties | |||
| Number of amino acids: | 117 | ||
| Molecular weight: | 12,537.093 | ||
| Theoretical pI: | 4.711 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11460 | ||
| Instability index: | 38.905 | ||
| aromaticity | 0.077 | ||
| GRAVY | -0.052 | ||
Secondary Structure Fraction | |||
| Helix | 0.256 | ||
| turn | 0.231 | ||
| sheet | 0.359 | ||