Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339336.1 | 5prime_partial | 117 | 3-356(+) |
Amino Acid sequence : | |||
ARGLDATEEYMRSVMDLMAIDRPNLAVARSYMVTDHTHSGLDEVDYGWGKAAYGGAATVGIHSAPGLVSFATPFKNENGEDGIVVPMSLPPDAMDLFAEELQRMLMAARKGFTASAL* | |||
Physicochemical properties | |||
Number of amino acids: | 117 | ||
Molecular weight: | 12,537.093 | ||
Theoretical pI: | 4.711 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11460 | ||
Instability index: | 38.905 | ||
aromaticity | 0.077 | ||
GRAVY | -0.052 | ||
Secondary Structure Fraction | |||
Helix | 0.256 | ||
turn | 0.231 | ||
sheet | 0.359 |