Acc_NO	ORF type	length	start-end position (strand +/-)
>DY339341.1	complete	106	405-85(-)
Amino Acid sequence :
MRASSHNILGMLSRFTFDPGISDQFTEISIMGMRKSLHKYTNSTSKHHLFKRILMKSFRAAALVNILKPHCVSLIPGPAAKRTTKWNPFIKKFRYHFLVDRAFSSR*
Physicochemical properties
Number of amino acids:		106
Molecular weight:		11,686.013
Theoretical pI:		9.722
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		24980 25105
Instability index:		23.142
aromaticity		0.118
GRAVY		0.457
Secondary Structure Fraction
Helix		0.412
turn		0.196
sheet		0.284

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY339341.1	complete	102	137-445(+)
Amino Acid sequence :
MKGFHLVVLLAAGPGIKDTQCGFKMFTRAAARKLFINIRLKRWCFDVELVYLCKLFLIPMIEISVNWSEIPGSKVNLLSIPNMLWELALMSVGYRTGTWKVH*
Physicochemical properties
Number of amino acids:		102
Molecular weight:		11,686.013
Theoretical pI:		9.722
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		24980 25105
Instability index:		23.142
aromaticity		0.118
GRAVY		0.457
Secondary Structure Fraction
Helix		0.412
turn		0.196
sheet		0.284