| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339346.1 | 5prime_partial | 254 | 2-766(+) |
Amino Acid sequence : | |||
| GTSEIYHQVEAKRAQISPKKVSEYQVIEIAENVCNLKKQEADWILKIDIVEKGDKLELVEQDSEGQCNSECKTIERACQEVLGFSDTDVAEYLYQKKPQLDALTKFICKDLTGACSSKPP PVPKDRTPGEPFIAKSEKEAEMERLMKSMEGMPGAPGMKMYSREDLMNQNFGAEGGDDDEDDDADEFPSNLGKILKQKNEKKIDWKERITKGIIDAGEKLKWQADRVSYKVKRWWQSKKT EWKKSSQSSGKTEL* | |||
Physicochemical properties | |||
| Number of amino acids: | 254 | ||
| Molecular weight: | 18,606.035 | ||
| Theoretical pI: | 6.263 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15720 | ||
| Instability index: | 59.679 | ||
| aromaticity | 0.185 | ||
| GRAVY | 0.399 | ||
Secondary Structure Fraction | |||
| Helix | 0.363 | ||
| turn | 0.363 | ||
| sheet | 0.196 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339346.1 | complete | 168 | 789-283(-) |
Amino Acid sequence : | |||
| MLFSSFDFYSSVLPDDCELFFHSVFLLCHHRFTLYETRSACHFSFSPASMIPLVILSFQSIFFSFFCFNIFPKFEGNSSASSSSSSSPPSAPKFWFIKSSREYIFMPGAPGIPSMDFISL SISASFSDLAINGSPGVLSLGTGGGFELHAPVRSLHMNFVRASSWGFF* | |||
Physicochemical properties | |||
| Number of amino acids: | 168 | ||
| Molecular weight: | 18,606.035 | ||
| Theoretical pI: | 6.263 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15720 | ||
| Instability index: | 59.679 | ||
| aromaticity | 0.185 | ||
| GRAVY | 0.399 | ||
Secondary Structure Fraction | |||
| Helix | 0.363 | ||
| turn | 0.363 | ||
| sheet | 0.196 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339346.1 | 5prime_partial | 254 | 2-766(+) |
Amino Acid sequence : | |||
| GTSEIYHQVEAKRAQISPKKVSEYQVIEIAENVCNLKKQEADWILKIDIVEKGDKLELVEQDSEGQCNSECKTIERACQEVLGFSDTDVAEYLYQKKPQLDALTKFICKDLTGACSSKPP PVPKDRTPGEPFIAKSEKEAEMERLMKSMEGMPGAPGMKMYSREDLMNQNFGAEGGDDDEDDDADEFPSNLGKILKQKNEKKIDWKERITKGIIDAGEKLKWQADRVSYKVKRWWQSKKT EWKKSSQSSGKTEL* | |||
Physicochemical properties | |||
| Number of amino acids: | 254 | ||
| Molecular weight: | 18,606.035 | ||
| Theoretical pI: | 6.263 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15720 | ||
| Instability index: | 59.679 | ||
| aromaticity | 0.185 | ||
| GRAVY | 0.399 | ||
Secondary Structure Fraction | |||
| Helix | 0.363 | ||
| turn | 0.363 | ||
| sheet | 0.196 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339346.1 | complete | 168 | 789-283(-) |
Amino Acid sequence : | |||
| MLFSSFDFYSSVLPDDCELFFHSVFLLCHHRFTLYETRSACHFSFSPASMIPLVILSFQSIFFSFFCFNIFPKFEGNSSASSSSSSSPPSAPKFWFIKSSREYIFMPGAPGIPSMDFISL SISASFSDLAINGSPGVLSLGTGGGFELHAPVRSLHMNFVRASSWGFF* | |||
Physicochemical properties | |||
| Number of amino acids: | 168 | ||
| Molecular weight: | 18,606.035 | ||
| Theoretical pI: | 6.263 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15720 | ||
| Instability index: | 59.679 | ||
| aromaticity | 0.185 | ||
| GRAVY | 0.399 | ||
Secondary Structure Fraction | |||
| Helix | 0.363 | ||
| turn | 0.363 | ||
| sheet | 0.196 | ||