Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339347.1 | 5prime_partial | 202 | 729-121(-) |
Amino Acid sequence : | |||
GDKLELVEQDSEGQCNSECKTIEGACQEVLGFSDTDVAEYLYQKKPQLDALPKFICKGLTGACSLKPPPVPKDRTPGEPFIAKLEKEAEMERLMKSMEGMPGAPGMKMYSPEDLMNQNFG AEGGDDDEDDDADEFPSNLGKILKQKNEKKIDWKERITKGIIDAGEKVKWQADRVSYKVKRWWQSKKTEWKKSSQSFGKTEL* | |||
Physicochemical properties | |||
Number of amino acids: | 202 | ||
Molecular weight: | 18,484.989 | ||
Theoretical pI: | 8.442 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15720 | ||
Instability index: | 55.217 | ||
aromaticity | 0.185 | ||
GRAVY | 0.389 | ||
Secondary Structure Fraction | |||
Helix | 0.357 | ||
turn | 0.387 | ||
sheet | 0.190 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339347.1 | complete | 168 | 98-604(+) |
Amino Acid sequence : | |||
MLFSSFNFYSSVLPNDCELFFHSVFLLCHHRFTLYETRSACHFTFSPASMIPLVILSFQSIFFSFFCFNIFPKFEGNSSASSSSSSSPPSAPKFWFIKSSGEYIFMPGAPGIPSMDFISL SISASFSNLAINGSPGVLSLGTGGGFKLHAPVRPLHMNFGRASSWGFF* | |||
Physicochemical properties | |||
Number of amino acids: | 168 | ||
Molecular weight: | 18,484.989 | ||
Theoretical pI: | 8.442 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15720 | ||
Instability index: | 55.217 | ||
aromaticity | 0.185 | ||
GRAVY | 0.389 | ||
Secondary Structure Fraction | |||
Helix | 0.357 | ||
turn | 0.387 | ||
sheet | 0.190 |