Acc_NO	ORF type	length	start-end position (strand +/-)
>DY339347.1	5prime_partial	202	729-121(-)
Amino Acid sequence :
GDKLELVEQDSEGQCNSECKTIEGACQEVLGFSDTDVAEYLYQKKPQLDALPKFICKGLTGACSLKPPPVPKDRTPGEPFIAKLEKEAEMERLMKSMEGMPGAPGMKMYSPEDLMNQNFG AEGGDDDEDDDADEFPSNLGKILKQKNEKKIDWKERITKGIIDAGEKVKWQADRVSYKVKRWWQSKKTEWKKSSQSFGKTEL*
Physicochemical properties
Number of amino acids:		202
Molecular weight:		18,484.989
Theoretical pI:		8.442
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		15470 15720
Instability index:		55.217
aromaticity		0.185
GRAVY		0.389
Secondary Structure Fraction
Helix		0.357
turn		0.387
sheet		0.190

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY339347.1	complete	168	98-604(+)
Amino Acid sequence :
MLFSSFNFYSSVLPNDCELFFHSVFLLCHHRFTLYETRSACHFTFSPASMIPLVILSFQSIFFSFFCFNIFPKFEGNSSASSSSSSSPPSAPKFWFIKSSGEYIFMPGAPGIPSMDFISL SISASFSNLAINGSPGVLSLGTGGGFKLHAPVRPLHMNFGRASSWGFF*
Physicochemical properties
Number of amino acids:		168
Molecular weight:		18,484.989
Theoretical pI:		8.442
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		15470 15720
Instability index:		55.217
aromaticity		0.185
GRAVY		0.389
Secondary Structure Fraction
Helix		0.357
turn		0.387
sheet		0.190