Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339350.1 | 5prime_partial | 161 | 649-164(-) |
Amino Acid sequence : | |||
KWSSRMTSISSPAVHAANNSTLILVISLGFLSSQPRAEFGTRKTVEFSPAEVARVFKYLYQSSANPIFENMTWRQCGEAFASDIVRYFKELQPDAQSWLVKSNPVLAGNAPWVALDVTDG LDIRHLNPEEKKVIARAKNHLLRSMQLKGRESLSAEALLES* | |||
Physicochemical properties | |||
Number of amino acids: | 161 | ||
Molecular weight: | 11,490.244 | ||
Theoretical pI: | 9.364 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 18240 | ||
Instability index: | 40.337 | ||
aromaticity | 0.099 | ||
GRAVY | -0.253 | ||
Secondary Structure Fraction | |||
Helix | 0.307 | ||
turn | 0.287 | ||
sheet | 0.178 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339350.1 | complete | 119 | 249-608(+) |
Amino Acid sequence : | |||
MTFFSSGFKCLISRPSVTSKATHGAFPARTGLDLTSQLCASGWSSLKYLTISLAKASPHCLHVIFSKMGFAELWYKYLKTLATSAGLNSTVFLVPNSARGWLERNPRLMTKIRVELFAA* | |||
Physicochemical properties | |||
Number of amino acids: | 119 | ||
Molecular weight: | 11,490.244 | ||
Theoretical pI: | 9.364 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 18240 | ||
Instability index: | 40.337 | ||
aromaticity | 0.099 | ||
GRAVY | -0.253 | ||
Secondary Structure Fraction | |||
Helix | 0.307 | ||
turn | 0.287 | ||
sheet | 0.178 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339350.1 | complete | 101 | 275-580(+) |
Amino Acid sequence : | |||
MPYIKAISNIQSNPWCIPSQNWIGFNQPTLCIWLELFEISNNITGKGFTTLPPCHILENGICRTLVQVLKNSCNFSRTKFHRLPRAEFGTRLAGKKPKADD* | |||
Physicochemical properties | |||
Number of amino acids: | 101 | ||
Molecular weight: | 11,490.244 | ||
Theoretical pI: | 9.364 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 18240 | ||
Instability index: | 40.337 | ||
aromaticity | 0.099 | ||
GRAVY | -0.253 | ||
Secondary Structure Fraction | |||
Helix | 0.307 | ||
turn | 0.287 | ||
sheet | 0.178 |