| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339356.1 | 5prime_partial | 207 | 653-30(-) |
Amino Acid sequence : | |||
| KDLYAGNKMTLQFSKDTNQQKFLPRQVADSIPFSSDKLPEIYTKFSVEPDSDEAEAMKKTIEECEEKGIKGEEKVCATSLESMVDFATSKIGNNVEAVSTEAHSSERKVYRIEGVSRKPS NKPVVVCHQQEYEYAVFYCHKTETTVAYDVSLVGAGGSKAETVAVCHRDTAEWNPKHLAFQVLKVKPGTVPVCHYLPENHIVWVSKN* | |||
Physicochemical properties | |||
| Number of amino acids: | 207 | ||
| Molecular weight: | 15,386.969 | ||
| Theoretical pI: | 10.166 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20190 | ||
| Instability index: | 79.416 | ||
| aromaticity | 0.064 | ||
| GRAVY | -1.112 | ||
Secondary Structure Fraction | |||
| Helix | 0.150 | ||
| turn | 0.407 | ||
| sheet | 0.150 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339356.1 | 5prime_partial | 140 | 2-424(+) |
Amino Acid sequence : | |||
| IKRMVNYYSSNSSKPTQCDSQGDNGRLAQSLASPSTPEKPNASDSTPPCPYGTPPQSQPLTRRPPREKHRRPPSSQSCGSKTQHTHTPAGGTRPPACYSASSTLPRYGTLSSPNYALLST LLRRCSLFSTWRNRPWTPEK* | |||
Physicochemical properties | |||
| Number of amino acids: | 140 | ||
| Molecular weight: | 15,386.969 | ||
| Theoretical pI: | 10.166 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20190 | ||
| Instability index: | 79.416 | ||
| aromaticity | 0.064 | ||
| GRAVY | -1.112 | ||
Secondary Structure Fraction | |||
| Helix | 0.150 | ||
| turn | 0.407 | ||
| sheet | 0.150 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339356.1 | 5prime_partial | 207 | 653-30(-) |
Amino Acid sequence : | |||
| KDLYAGNKMTLQFSKDTNQQKFLPRQVADSIPFSSDKLPEIYTKFSVEPDSDEAEAMKKTIEECEEKGIKGEEKVCATSLESMVDFATSKIGNNVEAVSTEAHSSERKVYRIEGVSRKPS NKPVVVCHQQEYEYAVFYCHKTETTVAYDVSLVGAGGSKAETVAVCHRDTAEWNPKHLAFQVLKVKPGTVPVCHYLPENHIVWVSKN* | |||
Physicochemical properties | |||
| Number of amino acids: | 207 | ||
| Molecular weight: | 15,386.969 | ||
| Theoretical pI: | 10.166 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20190 | ||
| Instability index: | 79.416 | ||
| aromaticity | 0.064 | ||
| GRAVY | -1.112 | ||
Secondary Structure Fraction | |||
| Helix | 0.150 | ||
| turn | 0.407 | ||
| sheet | 0.150 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339356.1 | 5prime_partial | 140 | 2-424(+) |
Amino Acid sequence : | |||
| IKRMVNYYSSNSSKPTQCDSQGDNGRLAQSLASPSTPEKPNASDSTPPCPYGTPPQSQPLTRRPPREKHRRPPSSQSCGSKTQHTHTPAGGTRPPACYSASSTLPRYGTLSSPNYALLST LLRRCSLFSTWRNRPWTPEK* | |||
Physicochemical properties | |||
| Number of amino acids: | 140 | ||
| Molecular weight: | 15,386.969 | ||
| Theoretical pI: | 10.166 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20190 | ||
| Instability index: | 79.416 | ||
| aromaticity | 0.064 | ||
| GRAVY | -1.112 | ||
Secondary Structure Fraction | |||
| Helix | 0.150 | ||
| turn | 0.407 | ||
| sheet | 0.150 | ||