Acc_NO	ORF type	length	start-end position (strand +/-)
>DY339365.1	complete	170	694-182(-)
Amino Acid sequence :
MPRYRPTNWHCKTNYVQNVYYLIVLIFLQLYVYCFPRKKKKKKLEVDGIDKLDIEFGTRPRAEFGTRLANNPAQWKKPEEFRPERFLEEEAKVEANGNDFRYLPFGVGRRSCPGIILALP ILGITLGRLVQNFELLPPPGQSKIDTTEKGGQFSLHILKHSTIVLKPRSV*
Physicochemical properties
Number of amino acids:		170
Molecular weight:		14,125.256
Theoretical pI:		11.861
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		24980 25105
Instability index:		74.456
aromaticity		0.071
GRAVY		-0.509
Secondary Structure Fraction
Helix		0.244
turn		0.346
sheet		0.189

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY339365.1	complete	130	215-607(+)
Amino Acid sequence :
MLQNVKTELPTFLRRIDLRLPRGRQQLEVLYESAQRNTQNRQCKDNTRAAPSANAEGEVPKVIAIGLDFSLLFQESLGPELLGLFPLGRVVGQPRAEFGTRPRAEFDIKLIDTVDLEFFF FFFSGETIYI*
Physicochemical properties
Number of amino acids:		130
Molecular weight:		14,125.256
Theoretical pI:		11.861
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		24980 25105
Instability index:		74.456
aromaticity		0.071
GRAVY		-0.509
Secondary Structure Fraction
Helix		0.244
turn		0.346
sheet		0.189

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY339365.1	complete	127	603-220(-)
Amino Acid sequence :
MYIVSPEKKKKKNSRSTVSISLISNSARGLVPNSARGWPTTRPNGKSPRSSGPRDSWKRRLKSRPMAMTLGTSPSALAEGAALVLSLHCLFWVLRWADSYRTSSCCLPRGSRRSIRRRKV GSSVFTF*
Physicochemical properties
Number of amino acids:		127
Molecular weight:		14,125.256
Theoretical pI:		11.861
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		24980 25105
Instability index:		74.456
aromaticity		0.071
GRAVY		-0.509
Secondary Structure Fraction
Helix		0.244
turn		0.346
sheet		0.189