Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339366.1 | 5prime_partial | 134 | 409-5(-) |
Amino Acid sequence : | |||
CDTLGVNSTQICIFEKPNKVSLSCLLQSQDSMALETQISLEVLSNFTNKPLEWQLPDQKLSTLLVLADFTKSNGSRPVSVRLLDSSSCWGRFPSGLGGKLLPWSLSSSGFTGSLLRTSHL TCLNLLKVEGFLEL* | |||
Physicochemical properties | |||
Number of amino acids: | 134 | ||
Molecular weight: | 13,400.484 | ||
Theoretical pI: | 10.873 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
Instability index: | 35.268 | ||
aromaticity | 0.059 | ||
GRAVY | -0.591 | ||
Secondary Structure Fraction | |||
Helix | 0.244 | ||
turn | 0.134 | ||
sheet | 0.294 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339366.1 | 3prime_partial | 119 | 53-409(+) |
Amino Acid sequence : | |||
MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVT | |||
Physicochemical properties | |||
Number of amino acids: | 119 | ||
Molecular weight: | 13,400.484 | ||
Theoretical pI: | 10.873 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
Instability index: | 35.268 | ||
aromaticity | 0.059 | ||
GRAVY | -0.591 | ||
Secondary Structure Fraction | |||
Helix | 0.244 | ||
turn | 0.134 | ||
sheet | 0.294 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339366.1 | 5prime_partial | 134 | 409-5(-) |
Amino Acid sequence : | |||
CDTLGVNSTQICIFEKPNKVSLSCLLQSQDSMALETQISLEVLSNFTNKPLEWQLPDQKLSTLLVLADFTKSNGSRPVSVRLLDSSSCWGRFPSGLGGKLLPWSLSSSGFTGSLLRTSHL TCLNLLKVEGFLEL* | |||
Physicochemical properties | |||
Number of amino acids: | 134 | ||
Molecular weight: | 13,400.484 | ||
Theoretical pI: | 10.873 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
Instability index: | 35.268 | ||
aromaticity | 0.059 | ||
GRAVY | -0.591 | ||
Secondary Structure Fraction | |||
Helix | 0.244 | ||
turn | 0.134 | ||
sheet | 0.294 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339366.1 | 3prime_partial | 119 | 53-409(+) |
Amino Acid sequence : | |||
MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVT | |||
Physicochemical properties | |||
Number of amino acids: | 119 | ||
Molecular weight: | 13,400.484 | ||
Theoretical pI: | 10.873 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
Instability index: | 35.268 | ||
aromaticity | 0.059 | ||
GRAVY | -0.591 | ||
Secondary Structure Fraction | |||
Helix | 0.244 | ||
turn | 0.134 | ||
sheet | 0.294 |