| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339366.1 | 5prime_partial | 134 | 409-5(-) |
Amino Acid sequence : | |||
| CDTLGVNSTQICIFEKPNKVSLSCLLQSQDSMALETQISLEVLSNFTNKPLEWQLPDQKLSTLLVLADFTKSNGSRPVSVRLLDSSSCWGRFPSGLGGKLLPWSLSSSGFTGSLLRTSHL TCLNLLKVEGFLEL* | |||
Physicochemical properties | |||
| Number of amino acids: | 134 | ||
| Molecular weight: | 13,400.484 | ||
| Theoretical pI: | 10.873 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
| Instability index: | 35.268 | ||
| aromaticity | 0.059 | ||
| GRAVY | -0.591 | ||
Secondary Structure Fraction | |||
| Helix | 0.244 | ||
| turn | 0.134 | ||
| sheet | 0.294 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339366.1 | 3prime_partial | 119 | 53-409(+) |
Amino Acid sequence : | |||
| MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVT | |||
Physicochemical properties | |||
| Number of amino acids: | 119 | ||
| Molecular weight: | 13,400.484 | ||
| Theoretical pI: | 10.873 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
| Instability index: | 35.268 | ||
| aromaticity | 0.059 | ||
| GRAVY | -0.591 | ||
Secondary Structure Fraction | |||
| Helix | 0.244 | ||
| turn | 0.134 | ||
| sheet | 0.294 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339366.1 | 5prime_partial | 134 | 409-5(-) |
Amino Acid sequence : | |||
| CDTLGVNSTQICIFEKPNKVSLSCLLQSQDSMALETQISLEVLSNFTNKPLEWQLPDQKLSTLLVLADFTKSNGSRPVSVRLLDSSSCWGRFPSGLGGKLLPWSLSSSGFTGSLLRTSHL TCLNLLKVEGFLEL* | |||
Physicochemical properties | |||
| Number of amino acids: | 134 | ||
| Molecular weight: | 13,400.484 | ||
| Theoretical pI: | 10.873 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
| Instability index: | 35.268 | ||
| aromaticity | 0.059 | ||
| GRAVY | -0.591 | ||
Secondary Structure Fraction | |||
| Helix | 0.244 | ||
| turn | 0.134 | ||
| sheet | 0.294 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339366.1 | 3prime_partial | 119 | 53-409(+) |
Amino Acid sequence : | |||
| MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVT | |||
Physicochemical properties | |||
| Number of amino acids: | 119 | ||
| Molecular weight: | 13,400.484 | ||
| Theoretical pI: | 10.873 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
| Instability index: | 35.268 | ||
| aromaticity | 0.059 | ||
| GRAVY | -0.591 | ||
Secondary Structure Fraction | |||
| Helix | 0.244 | ||
| turn | 0.134 | ||
| sheet | 0.294 | ||