| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339373.1 | complete | 134 | 123-527(+) |
Amino Acid sequence : | |||
| MGLLDKLWDETLAGPPPDSGLGKLRKYNSFSPRSAALPTADPVPPPQIDKVSPTPSIPVPLSNNYRNLRLSVDSPPIPSSPAGSSAPDSPFSPNTPGGNFKKLTRRKSATAALPNTVSKS PTGYDWIVLSALDR* | |||
Physicochemical properties | |||
| Number of amino acids: | 134 | ||
| Molecular weight: | 14,158.860 | ||
| Theoretical pI: | 9.751 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
| Instability index: | 64.127 | ||
| aromaticity | 0.060 | ||
| GRAVY | -0.504 | ||
Secondary Structure Fraction | |||
| Helix | 0.239 | ||
| turn | 0.425 | ||
| sheet | 0.194 | ||