| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339376.1 | complete | 248 | 1-747(+) |
Amino Acid sequence : | |||
| MVLKVDLQCPFCYKKVKKILCKFPQIRDQVYNEKANTVTITVVCCDPEKIRDKLCCKGAKVIKSIEIKEPPPKPKDPPKPKDPEKPKTEEPKTPEKPKVTFVEPPKDPKPQPTPKEKPPP PVEKPPQPPPQEQPQPPPKEKPPAPQPEKPKDVPKPAPPPAPFPVPVPTPPPAEPVPVCWAPPVRTCCGPCSEGYGGGPCYFGYGVAPPPPQPHYEGYCGYGYHERPCHVTRCDYYFSEE NPQACSIM* | |||
Physicochemical properties | |||
| Number of amino acids: | 248 | ||
| Molecular weight: | 11,553.987 | ||
| Theoretical pI: | 6.009 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11000 | ||
| Instability index: | 81.580 | ||
| aromaticity | 0.061 | ||
| GRAVY | 0.202 | ||
Secondary Structure Fraction | |||
| Helix | 0.174 | ||
| turn | 0.278 | ||
| sheet | 0.478 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339376.1 | complete | 115 | 682-335(-) |
Amino Acid sequence : | |||
| MAFHGIRTRSSPHSAAAAAAAPPHTQSNMAPHHNPLSMAHNMSSPVAPSTLAPAPPEAALAPGLETAPAAVPVSERPWAFPAAAPVAFLLEEAAAAPEAEAAAAFRPAAAAFLWV* | |||
Physicochemical properties | |||
| Number of amino acids: | 115 | ||
| Molecular weight: | 11,553.987 | ||
| Theoretical pI: | 6.009 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11000 | ||
| Instability index: | 81.580 | ||
| aromaticity | 0.061 | ||
| GRAVY | 0.202 | ||
Secondary Structure Fraction | |||
| Helix | 0.174 | ||
| turn | 0.278 | ||
| sheet | 0.478 | ||