Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339376.1 | complete | 248 | 1-747(+) |
Amino Acid sequence : | |||
MVLKVDLQCPFCYKKVKKILCKFPQIRDQVYNEKANTVTITVVCCDPEKIRDKLCCKGAKVIKSIEIKEPPPKPKDPPKPKDPEKPKTEEPKTPEKPKVTFVEPPKDPKPQPTPKEKPPP PVEKPPQPPPQEQPQPPPKEKPPAPQPEKPKDVPKPAPPPAPFPVPVPTPPPAEPVPVCWAPPVRTCCGPCSEGYGGGPCYFGYGVAPPPPQPHYEGYCGYGYHERPCHVTRCDYYFSEE NPQACSIM* | |||
Physicochemical properties | |||
Number of amino acids: | 248 | ||
Molecular weight: | 11,553.987 | ||
Theoretical pI: | 6.009 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11000 | ||
Instability index: | 81.580 | ||
aromaticity | 0.061 | ||
GRAVY | 0.202 | ||
Secondary Structure Fraction | |||
Helix | 0.174 | ||
turn | 0.278 | ||
sheet | 0.478 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339376.1 | complete | 115 | 682-335(-) |
Amino Acid sequence : | |||
MAFHGIRTRSSPHSAAAAAAAPPHTQSNMAPHHNPLSMAHNMSSPVAPSTLAPAPPEAALAPGLETAPAAVPVSERPWAFPAAAPVAFLLEEAAAAPEAEAAAAFRPAAAAFLWV* | |||
Physicochemical properties | |||
Number of amino acids: | 115 | ||
Molecular weight: | 11,553.987 | ||
Theoretical pI: | 6.009 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11000 | ||
Instability index: | 81.580 | ||
aromaticity | 0.061 | ||
GRAVY | 0.202 | ||
Secondary Structure Fraction | |||
Helix | 0.174 | ||
turn | 0.278 | ||
sheet | 0.478 |