Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339377.1 | 5prime_partial | 217 | 803-150(-) |
Amino Acid sequence : | |||
NEKANPVTITVVCCDPEKIRDKLCCKGAKVIKSIEIKEPPPKPKDPPKPKDPEKPKTEEPKTPEKPKVTFVEPPKDPKPQPTPKEKPPPPVEKPPQPPPQEQPQPPPKEKPPAPQPEKPK DVPKPAPPPAPFPVPVPTPPPAEPVPVCWAPPVRTCCGPCSEGYGGGPCYFGYGVAPPPPQPHYEGYCGYGYHERPCHVTRCDYYFSEENPQACSIM* | |||
Physicochemical properties | |||
Number of amino acids: | 217 | ||
Molecular weight: | 11,525.931 | ||
Theoretical pI: | 5.765 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11000 | ||
Instability index: | 81.580 | ||
aromaticity | 0.061 | ||
GRAVY | 0.210 | ||
Secondary Structure Fraction | |||
Helix | 0.174 | ||
turn | 0.278 | ||
sheet | 0.478 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339377.1 | complete | 115 | 215-562(+) |
Amino Acid sequence : | |||
MAFHGIRTRSSPHSAAAAAAAPPHTQSNMAPHHNPLSMAHNMSSPVAPSTLAPAPPEAALAPGLETAPAAVPVSERPWAFPAAAPVAFLLEEAAAAPEAEAAAAFQPAAAAFLWV* | |||
Physicochemical properties | |||
Number of amino acids: | 115 | ||
Molecular weight: | 11,525.931 | ||
Theoretical pI: | 5.765 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11000 | ||
Instability index: | 81.580 | ||
aromaticity | 0.061 | ||
GRAVY | 0.210 | ||
Secondary Structure Fraction | |||
Helix | 0.174 | ||
turn | 0.278 | ||
sheet | 0.478 |