| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339381.1 | 3prime_partial | 247 | 54-794(+) |
Amino Acid sequence : | |||
| MGRKFFVGGNWKCNGTTEEVKKIVSTLNAAQLPSPDVVEVVVSPPFVFLPLVKESLRPDFQVAAQNCWVKKGGAYTGEVSAEMLVNLNVPWVILGHSERRALLNESNEFVGEKVAYALSQ GLKVIACIGETLEQREAGTTVDVVAAQTKAIAERISDWTNVVLAYEPVWAIGTGKVATPAQAQEVHFELRKWLQANVNAEVASSTRIIYGGSVNGGNCKELAGQTDVDGFLVGGASLKPE FIDIIKA | |||
Physicochemical properties | |||
| Number of amino acids: | 247 | ||
| Molecular weight: | 26,587.101 | ||
| Theoretical pI: | 5.381 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 38960 39210 | ||
| Instability index: | 24.766 | ||
| aromaticity | 0.077 | ||
| GRAVY | 0.063 | ||
Secondary Structure Fraction | |||
| Helix | 0.332 | ||
| turn | 0.235 | ||
| sheet | 0.271 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339381.1 | 3prime_partial | 247 | 54-794(+) |
Amino Acid sequence : | |||
| MGRKFFVGGNWKCNGTTEEVKKIVSTLNAAQLPSPDVVEVVVSPPFVFLPLVKESLRPDFQVAAQNCWVKKGGAYTGEVSAEMLVNLNVPWVILGHSERRALLNESNEFVGEKVAYALSQ GLKVIACIGETLEQREAGTTVDVVAAQTKAIAERISDWTNVVLAYEPVWAIGTGKVATPAQAQEVHFELRKWLQANVNAEVASSTRIIYGGSVNGGNCKELAGQTDVDGFLVGGASLKPE FIDIIKA | |||
Physicochemical properties | |||
| Number of amino acids: | 247 | ||
| Molecular weight: | 26,587.101 | ||
| Theoretical pI: | 5.381 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 38960 39210 | ||
| Instability index: | 24.766 | ||
| aromaticity | 0.077 | ||
| GRAVY | 0.063 | ||
Secondary Structure Fraction | |||
| Helix | 0.332 | ||
| turn | 0.235 | ||
| sheet | 0.271 | ||