| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339388.1 | 5prime_partial | 178 | 636-100(-) |
Amino Acid sequence : | |||
| AWVSCVRFSPHSMQPTIVSGSWDKTVKIWNLTNCKLRSTLAGHSGYVNPVAVSPDGSLCASGGKDGVILLWDLSEGKRPYSLHAGSIIQALSFSPNRYWLSSPTESSIKIWDLESKSFVV NLKVALKQESEMLYEGTQTAAAKTKVIYSPSLNWSADGSTLFSGYTDGLVRVWGIGRY* | |||
Physicochemical properties | |||
| Number of amino acids: | 178 | ||
| Molecular weight: | 19,452.884 | ||
| Theoretical pI: | 8.980 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 54430 54555 | ||
| Instability index: | 34.281 | ||
| aromaticity | 0.107 | ||
| GRAVY | -0.098 | ||
Secondary Structure Fraction | |||
| Helix | 0.331 | ||
| turn | 0.315 | ||
| sheet | 0.202 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339388.1 | 5prime_partial | 178 | 636-100(-) |
Amino Acid sequence : | |||
| AWVSCVRFSPHSMQPTIVSGSWDKTVKIWNLTNCKLRSTLAGHSGYVNPVAVSPDGSLCASGGKDGVILLWDLSEGKRPYSLHAGSIIQALSFSPNRYWLSSPTESSIKIWDLESKSFVV NLKVALKQESEMLYEGTQTAAAKTKVIYSPSLNWSADGSTLFSGYTDGLVRVWGIGRY* | |||
Physicochemical properties | |||
| Number of amino acids: | 178 | ||
| Molecular weight: | 19,452.884 | ||
| Theoretical pI: | 8.980 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 54430 54555 | ||
| Instability index: | 34.281 | ||
| aromaticity | 0.107 | ||
| GRAVY | -0.098 | ||
Secondary Structure Fraction | |||
| Helix | 0.331 | ||
| turn | 0.315 | ||
| sheet | 0.202 | ||