| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339391.1 | internal | 246 | 1-738(+) |
Amino Acid sequence : | |||
| REYLLEETTRKLQRNDTESVEKLKLIDNIQRLGIDYYFEDAIGAVLRSPFSAEEEEDLFTAALRFRLLRHNGIEISPEMFLKFKDERGNFDESDTLGLLSLYEASNLGVKGEEILEEAME FAEARLRRSLSELAAPLRGEVAQALDVPRHLRMARLEARLFIEQYGKQSDHDGDLLELAILDYNQVQAQHQSELTEITRWWKQLGLVEKLGFGRDRALECFLWTVGFLPHPKHSSSRIET AKASAL | |||
Physicochemical properties | |||
| Number of amino acids: | 246 | ||
| Molecular weight: | 13,247.870 | ||
| Theoretical pI: | 11.397 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 84.771 | ||
| aromaticity | 0.048 | ||
| GRAVY | -0.430 | ||
Secondary Structure Fraction | |||
| Helix | 0.192 | ||
| turn | 0.400 | ||
| sheet | 0.248 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339391.1 | complete | 125 | 485-108(-) |
Amino Acid sequence : | |||
| MNSLASNLAILRCLGTSRACATSPRSGAASSDSDLLKRASANSIASSSISSPFTPKFDASYKLSNPRVSDSSKFPLSSLNFRNISGLISMPLWRSKRKRRAAVKRSSSSSAEKGERSTAP MASSK* | |||
Physicochemical properties | |||
| Number of amino acids: | 125 | ||
| Molecular weight: | 13,247.870 | ||
| Theoretical pI: | 11.397 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 84.771 | ||
| aromaticity | 0.048 | ||
| GRAVY | -0.430 | ||
Secondary Structure Fraction | |||
| Helix | 0.192 | ||
| turn | 0.400 | ||
| sheet | 0.248 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339391.1 | internal | 246 | 1-738(+) |
Amino Acid sequence : | |||
| REYLLEETTRKLQRNDTESVEKLKLIDNIQRLGIDYYFEDAIGAVLRSPFSAEEEEDLFTAALRFRLLRHNGIEISPEMFLKFKDERGNFDESDTLGLLSLYEASNLGVKGEEILEEAME FAEARLRRSLSELAAPLRGEVAQALDVPRHLRMARLEARLFIEQYGKQSDHDGDLLELAILDYNQVQAQHQSELTEITRWWKQLGLVEKLGFGRDRALECFLWTVGFLPHPKHSSSRIET AKASAL | |||
Physicochemical properties | |||
| Number of amino acids: | 246 | ||
| Molecular weight: | 13,247.870 | ||
| Theoretical pI: | 11.397 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 84.771 | ||
| aromaticity | 0.048 | ||
| GRAVY | -0.430 | ||
Secondary Structure Fraction | |||
| Helix | 0.192 | ||
| turn | 0.400 | ||
| sheet | 0.248 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339391.1 | complete | 125 | 485-108(-) |
Amino Acid sequence : | |||
| MNSLASNLAILRCLGTSRACATSPRSGAASSDSDLLKRASANSIASSSISSPFTPKFDASYKLSNPRVSDSSKFPLSSLNFRNISGLISMPLWRSKRKRRAAVKRSSSSSAEKGERSTAP MASSK* | |||
Physicochemical properties | |||
| Number of amino acids: | 125 | ||
| Molecular weight: | 13,247.870 | ||
| Theoretical pI: | 11.397 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 84.771 | ||
| aromaticity | 0.048 | ||
| GRAVY | -0.430 | ||
Secondary Structure Fraction | |||
| Helix | 0.192 | ||
| turn | 0.400 | ||
| sheet | 0.248 | ||