Acc_NO	ORF type	length	start-end position (strand +/-)
>DY339397.1	5prime_partial	165	2-499(+)
Amino Acid sequence :
HQFSSSPRFSPLLPPFVNFLRLKLGTMANAASGMAVHDHCKLKFMELKAKRTHRFVVFKIEEKQKQVMVEKLGEPTETYEDFVASLPADECRYAVFDFDFTTTENVQKSKIFFVAWSPDT AKVRSKMIYASSKDRFKRELDGIQVELQATDPTEMDLDVFRSRAI*
Physicochemical properties
Number of amino acids:		165
Molecular weight:		15,755.312
Theoretical pI:		7.686
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		16960 17335
Instability index:		58.502
aromaticity		0.123
GRAVY		0.293
Secondary Structure Fraction
Helix		0.384
turn		0.225
sheet		0.297

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY339397.1	complete	138	511-95(-)
Amino Acid sequence :
MAKRSNGTTSENIEIHLSWISGLQLYLNAIQLPLEPVLGASIDHLAPHLGSVGRPCDEENLAFLNILRGCKVKIKNCISAFISRKACNEIFIGFSWFAKLFHHYLFLLLLNLEYYEAMCP FSFQLHKFQFAVIMHCHS*
Physicochemical properties
Number of amino acids:		138
Molecular weight:		15,755.312
Theoretical pI:		7.686
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		16960 17335
Instability index:		58.502
aromaticity		0.123
GRAVY		0.293
Secondary Structure Fraction
Helix		0.384
turn		0.225
sheet		0.297