| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339403.1 | 5prime_partial | 190 | 602-30(-) |
Amino Acid sequence : | |||
| VVLDGHLSLAVRPQPRARPVFPDLSETGAELRGKNMAQRHQLRGFIRGVAKHVALITSTDFLRAFGEVAMYALSNIRALLLNIHQNLAVIRIKTYIIGDKSNGTACVTDNLLVVDISLGG YFSKHHDHVGFGAGLTSNLALRVLSKAGVQHCIGNLIAELVGVPLIHRLRCKQEGLHLSSLNLRSKELQI* | |||
Physicochemical properties | |||
| Number of amino acids: | 190 | ||
| Molecular weight: | 19,438.703 | ||
| Theoretical pI: | 4.656 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11835 | ||
| Instability index: | 39.990 | ||
| aromaticity | 0.056 | ||
| GRAVY | -0.334 | ||
Secondary Structure Fraction | |||
| Helix | 0.260 | ||
| turn | 0.186 | ||
| sheet | 0.243 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339403.1 | 3prime_partial | 177 | 72-602(+) |
Amino Acid sequence : | |||
| METFLFTSESVNEGHPDKLCDQISDAVLDACLAQDPESKVACETCTKTNMVMVFGEITTKADVDYEKIVRDTCRAIGFVSDDVGLDADNCKVLVNIEQQSPDIAQGVHGHLTKRPEEIGA GDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNGTCPWLRPDGKTQVTVQYY | |||
Physicochemical properties | |||
| Number of amino acids: | 177 | ||
| Molecular weight: | 19,438.703 | ||
| Theoretical pI: | 4.656 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11835 | ||
| Instability index: | 39.990 | ||
| aromaticity | 0.056 | ||
| GRAVY | -0.334 | ||
Secondary Structure Fraction | |||
| Helix | 0.260 | ||
| turn | 0.186 | ||
| sheet | 0.243 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339403.1 | 5prime_partial | 190 | 602-30(-) |
Amino Acid sequence : | |||
| VVLDGHLSLAVRPQPRARPVFPDLSETGAELRGKNMAQRHQLRGFIRGVAKHVALITSTDFLRAFGEVAMYALSNIRALLLNIHQNLAVIRIKTYIIGDKSNGTACVTDNLLVVDISLGG YFSKHHDHVGFGAGLTSNLALRVLSKAGVQHCIGNLIAELVGVPLIHRLRCKQEGLHLSSLNLRSKELQI* | |||
Physicochemical properties | |||
| Number of amino acids: | 190 | ||
| Molecular weight: | 19,438.703 | ||
| Theoretical pI: | 4.656 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11835 | ||
| Instability index: | 39.990 | ||
| aromaticity | 0.056 | ||
| GRAVY | -0.334 | ||
Secondary Structure Fraction | |||
| Helix | 0.260 | ||
| turn | 0.186 | ||
| sheet | 0.243 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339403.1 | 3prime_partial | 177 | 72-602(+) |
Amino Acid sequence : | |||
| METFLFTSESVNEGHPDKLCDQISDAVLDACLAQDPESKVACETCTKTNMVMVFGEITTKADVDYEKIVRDTCRAIGFVSDDVGLDADNCKVLVNIEQQSPDIAQGVHGHLTKRPEEIGA GDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNGTCPWLRPDGKTQVTVQYY | |||
Physicochemical properties | |||
| Number of amino acids: | 177 | ||
| Molecular weight: | 19,438.703 | ||
| Theoretical pI: | 4.656 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11835 | ||
| Instability index: | 39.990 | ||
| aromaticity | 0.056 | ||
| GRAVY | -0.334 | ||
Secondary Structure Fraction | |||
| Helix | 0.260 | ||
| turn | 0.186 | ||
| sheet | 0.243 | ||