Acc_NO	ORF type	length	start-end position (strand +/-)
>DY339404.1	5prime_partial	168	2-508(+)
Amino Acid sequence :
APPKGPKKPNRRNLPHLHIRRREMSSEQIESHRANAEVYTGDAVCKQKSIELLEKINMPKGLLPLDDIVEVGHNAETGFVWLKQKKSKTHYFKGIGRSVWYDTEVTAFVSDRRMKRLTGV KSKEILIWITICDISIKDPESGKITFGTPTGISRAFPVSAFEEEEEKK*
Physicochemical properties
Number of amino acids:		168
Molecular weight:		19,144.829
Theoretical pI:		9.415
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		20970 21095
Instability index:		65.895
aromaticity		0.071
GRAVY		-0.636
Secondary Structure Fraction
Helix		0.274
turn		0.226
sheet		0.220