| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339420.1 | internal | 245 | 1-735(+) |
Amino Acid sequence : | |||
| APVTILVFCNIIIHVPPRGPIYTPPDVERLTESFSRLSVNQSYTVFYGGANFHVTGNGSGAALSLDKTSGSGLQSKNRYYYGFFNAAIKLPAGFTSGVVVAYYLSNSEAFPHNHDEIDFE LLGHEKRREWVLQTNMYGNGSVGTGREEKFYLWFDPTQSFHDYSILWNNHHIVFMVDNIPVREVVHNAAIASAYPSKAMSVYTTIWDGSQWATHGGKYPVNYKYAPFVVSMGGIEMEGCI FDVAP | |||
Physicochemical properties | |||
| Number of amino acids: | 245 | ||
| Molecular weight: | 27,328.405 | ||
| Theoretical pI: | 6.043 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 51340 51465 | ||
| Instability index: | 48.460 | ||
| aromaticity | 0.147 | ||
| GRAVY | -0.132 | ||
Secondary Structure Fraction | |||
| Helix | 0.347 | ||
| turn | 0.290 | ||
| sheet | 0.192 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339420.1 | internal | 245 | 1-735(+) |
Amino Acid sequence : | |||
| APVTILVFCNIIIHVPPRGPIYTPPDVERLTESFSRLSVNQSYTVFYGGANFHVTGNGSGAALSLDKTSGSGLQSKNRYYYGFFNAAIKLPAGFTSGVVVAYYLSNSEAFPHNHDEIDFE LLGHEKRREWVLQTNMYGNGSVGTGREEKFYLWFDPTQSFHDYSILWNNHHIVFMVDNIPVREVVHNAAIASAYPSKAMSVYTTIWDGSQWATHGGKYPVNYKYAPFVVSMGGIEMEGCI FDVAP | |||
Physicochemical properties | |||
| Number of amino acids: | 245 | ||
| Molecular weight: | 27,328.405 | ||
| Theoretical pI: | 6.043 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 51340 51465 | ||
| Instability index: | 48.460 | ||
| aromaticity | 0.147 | ||
| GRAVY | -0.132 | ||
Secondary Structure Fraction | |||
| Helix | 0.347 | ||
| turn | 0.290 | ||
| sheet | 0.192 | ||