| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339422.1 | 5prime_partial | 210 | 1-633(+) |
Amino Acid sequence : | |||
| APVDNDDLRRGKPTNLKVFGENAAVLAGDAMLSFAFEHVAAATRGVAPERVVRAVRELANLIGSEGLSGGQVVDVSAEGMAAVGLDHLELIHRLKTAALVQASVVLGAVVGGASEEEIEK LRRFASCIGLLFQVVDDILDVTKSSAELGKTAGKDLAADKATYPKLIGLEKSRELADKLNREAKEHLLHFDPHRAAPLIALADYIAYRDY* | |||
Physicochemical properties | |||
| Number of amino acids: | 210 | ||
| Molecular weight: | 11,249.805 | ||
| Theoretical pI: | 11.523 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 44.397 | ||
| aromaticity | 0.009 | ||
| GRAVY | -1.171 | ||
Secondary Structure Fraction | |||
| Helix | 0.077 | ||
| turn | 0.470 | ||
| sheet | 0.154 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339422.1 | 5prime_partial | 117 | 3-356(+) |
Amino Acid sequence : | |||
| TSGQRRPPPREAHQPQGVRRERGGAGRGRHAVVRVRTRGRGDEGRGAGESGEGGAGAGEFDRVGGAVGGAGGGRQRGGDGGRGTRSSGVDPPPEDGGAGAGVGGSGGGCGRSERGGN* | |||
Physicochemical properties | |||
| Number of amino acids: | 117 | ||
| Molecular weight: | 11,249.805 | ||
| Theoretical pI: | 11.523 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 44.397 | ||
| aromaticity | 0.009 | ||
| GRAVY | -1.171 | ||
Secondary Structure Fraction | |||
| Helix | 0.077 | ||
| turn | 0.470 | ||
| sheet | 0.154 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339422.1 | 5prime_partial | 210 | 1-633(+) |
Amino Acid sequence : | |||
| APVDNDDLRRGKPTNLKVFGENAAVLAGDAMLSFAFEHVAAATRGVAPERVVRAVRELANLIGSEGLSGGQVVDVSAEGMAAVGLDHLELIHRLKTAALVQASVVLGAVVGGASEEEIEK LRRFASCIGLLFQVVDDILDVTKSSAELGKTAGKDLAADKATYPKLIGLEKSRELADKLNREAKEHLLHFDPHRAAPLIALADYIAYRDY* | |||
Physicochemical properties | |||
| Number of amino acids: | 210 | ||
| Molecular weight: | 11,249.805 | ||
| Theoretical pI: | 11.523 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 44.397 | ||
| aromaticity | 0.009 | ||
| GRAVY | -1.171 | ||
Secondary Structure Fraction | |||
| Helix | 0.077 | ||
| turn | 0.470 | ||
| sheet | 0.154 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339422.1 | 5prime_partial | 117 | 3-356(+) |
Amino Acid sequence : | |||
| TSGQRRPPPREAHQPQGVRRERGGAGRGRHAVVRVRTRGRGDEGRGAGESGEGGAGAGEFDRVGGAVGGAGGGRQRGGDGGRGTRSSGVDPPPEDGGAGAGVGGSGGGCGRSERGGN* | |||
Physicochemical properties | |||
| Number of amino acids: | 117 | ||
| Molecular weight: | 11,249.805 | ||
| Theoretical pI: | 11.523 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 44.397 | ||
| aromaticity | 0.009 | ||
| GRAVY | -1.171 | ||
Secondary Structure Fraction | |||
| Helix | 0.077 | ||
| turn | 0.470 | ||
| sheet | 0.154 | ||