| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339423.1 | internal | 221 | 664-2(-) |
Amino Acid sequence : | |||
| RHEGDNDDLRRGKPTNHKVFGENAAVLAGDPMLSFAFEHVAVATRGVAPERVVRAVRELANLIGLEGLSGGQVVDVSAEGMAAVGLDHLELIPRLKTAAPVQASVVLGAVVGGASEEEIE KLRRFASCIGLLFQVVDDILDVTKLSAELGKTPGKDLAVDKAPYPNLIGLEKSRELPDKLNREAKEHLLQFDPHRAAPLIAFCRLYCLQKGLPYILLFLNN | |||
Physicochemical properties | |||
| Number of amino acids: | 221 | ||
| Molecular weight: | 23,885.288 | ||
| Theoretical pI: | 5.903 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4595 | ||
| Instability index: | 29.919 | ||
| aromaticity | 0.050 | ||
| GRAVY | 0.020 | ||
Secondary Structure Fraction | |||
| Helix | 0.326 | ||
| turn | 0.213 | ||
| sheet | 0.344 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339423.1 | internal | 221 | 664-2(-) |
Amino Acid sequence : | |||
| RHEGDNDDLRRGKPTNHKVFGENAAVLAGDPMLSFAFEHVAVATRGVAPERVVRAVRELANLIGLEGLSGGQVVDVSAEGMAAVGLDHLELIPRLKTAAPVQASVVLGAVVGGASEEEIE KLRRFASCIGLLFQVVDDILDVTKLSAELGKTPGKDLAVDKAPYPNLIGLEKSRELPDKLNREAKEHLLQFDPHRAAPLIAFCRLYCLQKGLPYILLFLNN | |||
Physicochemical properties | |||
| Number of amino acids: | 221 | ||
| Molecular weight: | 23,885.288 | ||
| Theoretical pI: | 5.903 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4595 | ||
| Instability index: | 29.919 | ||
| aromaticity | 0.050 | ||
| GRAVY | 0.020 | ||
Secondary Structure Fraction | |||
| Helix | 0.326 | ||
| turn | 0.213 | ||
| sheet | 0.344 | ||