Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339423.1 | internal | 221 | 664-2(-) |
Amino Acid sequence : | |||
RHEGDNDDLRRGKPTNHKVFGENAAVLAGDPMLSFAFEHVAVATRGVAPERVVRAVRELANLIGLEGLSGGQVVDVSAEGMAAVGLDHLELIPRLKTAAPVQASVVLGAVVGGASEEEIE KLRRFASCIGLLFQVVDDILDVTKLSAELGKTPGKDLAVDKAPYPNLIGLEKSRELPDKLNREAKEHLLQFDPHRAAPLIAFCRLYCLQKGLPYILLFLNN | |||
Physicochemical properties | |||
Number of amino acids: | 221 | ||
Molecular weight: | 23,885.288 | ||
Theoretical pI: | 5.903 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4595 | ||
Instability index: | 29.919 | ||
aromaticity | 0.050 | ||
GRAVY | 0.020 | ||
Secondary Structure Fraction | |||
Helix | 0.326 | ||
turn | 0.213 | ||
sheet | 0.344 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339423.1 | internal | 221 | 664-2(-) |
Amino Acid sequence : | |||
RHEGDNDDLRRGKPTNHKVFGENAAVLAGDPMLSFAFEHVAVATRGVAPERVVRAVRELANLIGLEGLSGGQVVDVSAEGMAAVGLDHLELIPRLKTAAPVQASVVLGAVVGGASEEEIE KLRRFASCIGLLFQVVDDILDVTKLSAELGKTPGKDLAVDKAPYPNLIGLEKSRELPDKLNREAKEHLLQFDPHRAAPLIAFCRLYCLQKGLPYILLFLNN | |||
Physicochemical properties | |||
Number of amino acids: | 221 | ||
Molecular weight: | 23,885.288 | ||
Theoretical pI: | 5.903 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4595 | ||
Instability index: | 29.919 | ||
aromaticity | 0.050 | ||
GRAVY | 0.020 | ||
Secondary Structure Fraction | |||
Helix | 0.326 | ||
turn | 0.213 | ||
sheet | 0.344 |