| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339429.1 | 5prime_partial | 159 | 1-480(+) |
Amino Acid sequence : | |||
| FSSLHNQRDLTLTLHKMSGDEPVVVDTPAAVPAPTLGEPMDVMTALQLVLKKALAHGGLVRGLHEAAKSIEKHHAMLCVVAEDCDQLEYVKLVKALCADHNVNLITVPSAKTLGEWAGLR KIDSEGKARKVVGASCVVVKDYGEESEGLHIIQEYVKSH* | |||
Physicochemical properties | |||
| Number of amino acids: | 159 | ||
| Molecular weight: | 17,181.686 | ||
| Theoretical pI: | 6.131 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10220 | ||
| Instability index: | 38.945 | ||
| aromaticity | 0.031 | ||
| GRAVY | -0.017 | ||
Secondary Structure Fraction | |||
| Helix | 0.302 | ||
| turn | 0.182 | ||
| sheet | 0.321 | ||