Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339429.1 | 5prime_partial | 159 | 1-480(+) |
Amino Acid sequence : | |||
FSSLHNQRDLTLTLHKMSGDEPVVVDTPAAVPAPTLGEPMDVMTALQLVLKKALAHGGLVRGLHEAAKSIEKHHAMLCVVAEDCDQLEYVKLVKALCADHNVNLITVPSAKTLGEWAGLR KIDSEGKARKVVGASCVVVKDYGEESEGLHIIQEYVKSH* | |||
Physicochemical properties | |||
Number of amino acids: | 159 | ||
Molecular weight: | 17,181.686 | ||
Theoretical pI: | 6.131 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10220 | ||
Instability index: | 38.945 | ||
aromaticity | 0.031 | ||
GRAVY | -0.017 | ||
Secondary Structure Fraction | |||
Helix | 0.302 | ||
turn | 0.182 | ||
sheet | 0.321 |