Acc_NO	ORF type	length	start-end position (strand +/-)
>DY339435.1	5prime_partial	193	2-583(+)
Amino Acid sequence :
HPVRAHFSYGIADDSYDPKYSHYKYWSNPLETRLPNAPDIEVFAMYGTGIPTERAYVYKQVPAADCYIPFQIDTSAVEEDIDRCIKDGVFTVDGDETVPTLSAGFMSAKAWRGKTRFNPS GMKNFVREYDHAPPATLLEGRGTQSGAHVDIMGNFALIEDIMRVAAGATGEELGGDRVYSDIFKWSDKINLPL*
Physicochemical properties
Number of amino acids:		193
Molecular weight:		21,495.823
Theoretical pI:		4.966
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		32890 33015
Instability index:		26.975
aromaticity		0.119
GRAVY		-0.392
Secondary Structure Fraction
Helix		0.290
turn		0.238
sheet		0.223