| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339435.1 | 5prime_partial | 193 | 2-583(+) |
Amino Acid sequence : | |||
| HPVRAHFSYGIADDSYDPKYSHYKYWSNPLETRLPNAPDIEVFAMYGTGIPTERAYVYKQVPAADCYIPFQIDTSAVEEDIDRCIKDGVFTVDGDETVPTLSAGFMSAKAWRGKTRFNPS GMKNFVREYDHAPPATLLEGRGTQSGAHVDIMGNFALIEDIMRVAAGATGEELGGDRVYSDIFKWSDKINLPL* | |||
Physicochemical properties | |||
| Number of amino acids: | 193 | ||
| Molecular weight: | 21,495.823 | ||
| Theoretical pI: | 4.966 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 32890 33015 | ||
| Instability index: | 26.975 | ||
| aromaticity | 0.119 | ||
| GRAVY | -0.392 | ||
Secondary Structure Fraction | |||
| Helix | 0.290 | ||
| turn | 0.238 | ||
| sheet | 0.223 | ||