Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339445.1 | 3prime_partial | 187 | 236-796(+) |
Amino Acid sequence : | |||
MGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEPYKGIGDCFKRTIKDEGFGSLWRGNTANVIRYFPTQALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLGSGGAAGASSLLFVYS LDYARTRLANDAKAAKKGGERQFNGLVDVYRKTLKSDGIAGLYRGFNISCVGIIVYRGLYFGMNDSL | |||
Physicochemical properties | |||
Number of amino acids: | 187 | ||
Molecular weight: | 20,720.511 | ||
Theoretical pI: | 9.809 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 31400 31525 | ||
Instability index: | 9.664 | ||
aromaticity | 0.139 | ||
GRAVY | -0.234 | ||
Secondary Structure Fraction | |||
Helix | 0.326 | ||
turn | 0.251 | ||
sheet | 0.230 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339445.1 | 3prime_partial | 187 | 236-796(+) |
Amino Acid sequence : | |||
MGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEPYKGIGDCFKRTIKDEGFGSLWRGNTANVIRYFPTQALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLGSGGAAGASSLLFVYS LDYARTRLANDAKAAKKGGERQFNGLVDVYRKTLKSDGIAGLYRGFNISCVGIIVYRGLYFGMNDSL | |||
Physicochemical properties | |||
Number of amino acids: | 187 | ||
Molecular weight: | 20,720.511 | ||
Theoretical pI: | 9.809 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 31400 31525 | ||
Instability index: | 9.664 | ||
aromaticity | 0.139 | ||
GRAVY | -0.234 | ||
Secondary Structure Fraction | |||
Helix | 0.326 | ||
turn | 0.251 | ||
sheet | 0.230 |