| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339445.1 | 3prime_partial | 187 | 236-796(+) |
Amino Acid sequence : | |||
| MGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEPYKGIGDCFKRTIKDEGFGSLWRGNTANVIRYFPTQALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLGSGGAAGASSLLFVYS LDYARTRLANDAKAAKKGGERQFNGLVDVYRKTLKSDGIAGLYRGFNISCVGIIVYRGLYFGMNDSL | |||
Physicochemical properties | |||
| Number of amino acids: | 187 | ||
| Molecular weight: | 20,720.511 | ||
| Theoretical pI: | 9.809 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 31400 31525 | ||
| Instability index: | 9.664 | ||
| aromaticity | 0.139 | ||
| GRAVY | -0.234 | ||
Secondary Structure Fraction | |||
| Helix | 0.326 | ||
| turn | 0.251 | ||
| sheet | 0.230 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339445.1 | 3prime_partial | 187 | 236-796(+) |
Amino Acid sequence : | |||
| MGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEPYKGIGDCFKRTIKDEGFGSLWRGNTANVIRYFPTQALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLGSGGAAGASSLLFVYS LDYARTRLANDAKAAKKGGERQFNGLVDVYRKTLKSDGIAGLYRGFNISCVGIIVYRGLYFGMNDSL | |||
Physicochemical properties | |||
| Number of amino acids: | 187 | ||
| Molecular weight: | 20,720.511 | ||
| Theoretical pI: | 9.809 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 31400 31525 | ||
| Instability index: | 9.664 | ||
| aromaticity | 0.139 | ||
| GRAVY | -0.234 | ||
Secondary Structure Fraction | |||
| Helix | 0.326 | ||
| turn | 0.251 | ||
| sheet | 0.230 | ||