| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339449.1 | internal | 238 | 1-714(+) |
Amino Acid sequence : | |||
| APLRKDIALANKETSFDGGPFVLPLAHKHKVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFRDWPVEKLKEVKVADALKHPNWNMGKKITVDSATLFNKGLEVIEAHYLFGAEY DNIEIVIHPQSIIHSMVETQDSSVLAQLGWPDMRLPILYTLSWPDRVYCSEITWPRLDLCKLGSLTFKAPDNVKYPSMDLAYSAGRAGGTMTGVLSAANEKAVELFISERISYLDIFK | |||
Physicochemical properties | |||
| Number of amino acids: | 238 | ||
| Molecular weight: | 26,421.227 | ||
| Theoretical pI: | 6.419 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 37930 38055 | ||
| Instability index: | 39.179 | ||
| aromaticity | 0.088 | ||
| GRAVY | -0.048 | ||
Secondary Structure Fraction | |||
| Helix | 0.332 | ||
| turn | 0.223 | ||
| sheet | 0.282 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339449.1 | internal | 238 | 1-714(+) |
Amino Acid sequence : | |||
| APLRKDIALANKETSFDGGPFVLPLAHKHKVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFRDWPVEKLKEVKVADALKHPNWNMGKKITVDSATLFNKGLEVIEAHYLFGAEY DNIEIVIHPQSIIHSMVETQDSSVLAQLGWPDMRLPILYTLSWPDRVYCSEITWPRLDLCKLGSLTFKAPDNVKYPSMDLAYSAGRAGGTMTGVLSAANEKAVELFISERISYLDIFK | |||
Physicochemical properties | |||
| Number of amino acids: | 238 | ||
| Molecular weight: | 26,421.227 | ||
| Theoretical pI: | 6.419 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 37930 38055 | ||
| Instability index: | 39.179 | ||
| aromaticity | 0.088 | ||
| GRAVY | -0.048 | ||
Secondary Structure Fraction | |||
| Helix | 0.332 | ||
| turn | 0.223 | ||
| sheet | 0.282 | ||