Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339462.1 | internal | 216 | 1-648(+) |
Amino Acid sequence : | |||
DIFILLGRKMSANCVSAAPTSPKNSDVEPIRKSATYHSSVWGNHFLSYTSDVTEITAAEKEQLEKLKEKVKNLLAQTPDESTGKMELIDAIQRLGVGYHFTTEIQESLRQIHEGQIRNDD DDVRVVALRFRLLRQGGYRAPCDVFEKFMDDGGNFKESLKKDVEGMLSLYEASYYGIDGEEIMDKALEFSSSHLESMLHNISTKTNKSLLRRLQEA | |||
Physicochemical properties | |||
Number of amino acids: | 216 | ||
Molecular weight: | 24,454.300 | ||
Theoretical pI: | 5.454 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 16055 | ||
Instability index: | 41.509 | ||
aromaticity | 0.074 | ||
GRAVY | -0.532 | ||
Secondary Structure Fraction | |||
Helix | 0.282 | ||
turn | 0.213 | ||
sheet | 0.282 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339462.1 | internal | 216 | 1-648(+) |
Amino Acid sequence : | |||
DIFILLGRKMSANCVSAAPTSPKNSDVEPIRKSATYHSSVWGNHFLSYTSDVTEITAAEKEQLEKLKEKVKNLLAQTPDESTGKMELIDAIQRLGVGYHFTTEIQESLRQIHEGQIRNDD DDVRVVALRFRLLRQGGYRAPCDVFEKFMDDGGNFKESLKKDVEGMLSLYEASYYGIDGEEIMDKALEFSSSHLESMLHNISTKTNKSLLRRLQEA | |||
Physicochemical properties | |||
Number of amino acids: | 216 | ||
Molecular weight: | 24,454.300 | ||
Theoretical pI: | 5.454 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 16055 | ||
Instability index: | 41.509 | ||
aromaticity | 0.074 | ||
GRAVY | -0.532 | ||
Secondary Structure Fraction | |||
Helix | 0.282 | ||
turn | 0.213 | ||
sheet | 0.282 |