| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339465.1 | internal | 221 | 1-663(+) |
Amino Acid sequence : | |||
| APVIQLHAQAWEHALTYINSTALSAAVELEIPDILEDHGGLMSLSELSAASGCPREPLYRLMRFLIFHGIFTKSDDCYAQSPLSRLFTRENLGPYMLMQATPVTRSPAGLSGEALKTGTS LYLKSIRGEDSWSDPAYGYHMKAFTNAMIAHARLTAAAIVSNYPAAFDGLRSVVDVGGRHGTAIGRLVEAFPWVRGIAFDLPEIVADAPPRKGVDFLGGDM | |||
Physicochemical properties | |||
| Number of amino acids: | 221 | ||
| Molecular weight: | 14,092.896 | ||
| Theoretical pI: | 11.558 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 72.115 | ||
| aromaticity | 0.040 | ||
| GRAVY | -0.682 | ||
Secondary Structure Fraction | |||
| Helix | 0.248 | ||
| turn | 0.184 | ||
| sheet | 0.264 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339465.1 | 5prime_partial | 127 | 3-386(+) |
Amino Acid sequence : | |||
| TRYTTSCTSMGARPNLHQLHGAVCGGGAGDSRHPGRSRRPDVAVGALRRLRLPPRAALPPHEIPHLPRHLHQIRRLLRPVAAFSAFHERESGTLHVDAGDAGNEVSCGLERRSLENGDKP LSQVDQR* | |||
Physicochemical properties | |||
| Number of amino acids: | 127 | ||
| Molecular weight: | 14,092.896 | ||
| Theoretical pI: | 11.558 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 72.115 | ||
| aromaticity | 0.040 | ||
| GRAVY | -0.682 | ||
Secondary Structure Fraction | |||
| Helix | 0.248 | ||
| turn | 0.184 | ||
| sheet | 0.264 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339465.1 | complete | 125 | 420-43(-) |
Amino Acid sequence : | |||
| MVAVGRVAPRILTSDRLEIKACPRFQGFAAQARRRPRYRRRLHQHVGSQILSREKPRKRRLGVAVVGFGEDAVEDEESHEAVERLAGAAGGGGELRQRHQAAVIFQDVGNLQLHRRRQRR GVDVS* | |||
Physicochemical properties | |||
| Number of amino acids: | 125 | ||
| Molecular weight: | 14,092.896 | ||
| Theoretical pI: | 11.558 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 72.115 | ||
| aromaticity | 0.040 | ||
| GRAVY | -0.682 | ||
Secondary Structure Fraction | |||
| Helix | 0.248 | ||
| turn | 0.184 | ||
| sheet | 0.264 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339465.1 | internal | 221 | 1-663(+) |
Amino Acid sequence : | |||
| APVIQLHAQAWEHALTYINSTALSAAVELEIPDILEDHGGLMSLSELSAASGCPREPLYRLMRFLIFHGIFTKSDDCYAQSPLSRLFTRENLGPYMLMQATPVTRSPAGLSGEALKTGTS LYLKSIRGEDSWSDPAYGYHMKAFTNAMIAHARLTAAAIVSNYPAAFDGLRSVVDVGGRHGTAIGRLVEAFPWVRGIAFDLPEIVADAPPRKGVDFLGGDM | |||
Physicochemical properties | |||
| Number of amino acids: | 221 | ||
| Molecular weight: | 14,092.896 | ||
| Theoretical pI: | 11.558 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 72.115 | ||
| aromaticity | 0.040 | ||
| GRAVY | -0.682 | ||
Secondary Structure Fraction | |||
| Helix | 0.248 | ||
| turn | 0.184 | ||
| sheet | 0.264 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339465.1 | 5prime_partial | 127 | 3-386(+) |
Amino Acid sequence : | |||
| TRYTTSCTSMGARPNLHQLHGAVCGGGAGDSRHPGRSRRPDVAVGALRRLRLPPRAALPPHEIPHLPRHLHQIRRLLRPVAAFSAFHERESGTLHVDAGDAGNEVSCGLERRSLENGDKP LSQVDQR* | |||
Physicochemical properties | |||
| Number of amino acids: | 127 | ||
| Molecular weight: | 14,092.896 | ||
| Theoretical pI: | 11.558 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 72.115 | ||
| aromaticity | 0.040 | ||
| GRAVY | -0.682 | ||
Secondary Structure Fraction | |||
| Helix | 0.248 | ||
| turn | 0.184 | ||
| sheet | 0.264 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339465.1 | complete | 125 | 420-43(-) |
Amino Acid sequence : | |||
| MVAVGRVAPRILTSDRLEIKACPRFQGFAAQARRRPRYRRRLHQHVGSQILSREKPRKRRLGVAVVGFGEDAVEDEESHEAVERLAGAAGGGGELRQRHQAAVIFQDVGNLQLHRRRQRR GVDVS* | |||
Physicochemical properties | |||
| Number of amino acids: | 125 | ||
| Molecular weight: | 14,092.896 | ||
| Theoretical pI: | 11.558 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 72.115 | ||
| aromaticity | 0.040 | ||
| GRAVY | -0.682 | ||
Secondary Structure Fraction | |||
| Helix | 0.248 | ||
| turn | 0.184 | ||
| sheet | 0.264 | ||