| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339469.1 | internal | 223 | 1-669(+) |
Amino Acid sequence : | |||
| APLKVMFKDDGKSRGFGFVAFEESGAAERAVKELNGKEMFEGKPLYVGRAQKKAERQQELKRKFEQLKIERLSRYQGVNLYVKNLDDTIDDERLRKEFNLFGTITSAKVMMEEGRSKGFG FVCFSSPEEATKAVTDMNGRIVGTKPLYVALAQRKEDRKAHLASQYMQRIANMRMQQIGPLFQPSGNGYFVPTIPPPQRFYGPTQMTQIRPHPRWSAQPQVRP | |||
Physicochemical properties | |||
| Number of amino acids: | 223 | ||
| Molecular weight: | 25,512.057 | ||
| Theoretical pI: | 9.864 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 15930 | ||
| Instability index: | 31.781 | ||
| aromaticity | 0.099 | ||
| GRAVY | -0.709 | ||
Secondary Structure Fraction | |||
| Helix | 0.256 | ||
| turn | 0.224 | ||
| sheet | 0.251 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339469.1 | internal | 223 | 1-669(+) |
Amino Acid sequence : | |||
| APLKVMFKDDGKSRGFGFVAFEESGAAERAVKELNGKEMFEGKPLYVGRAQKKAERQQELKRKFEQLKIERLSRYQGVNLYVKNLDDTIDDERLRKEFNLFGTITSAKVMMEEGRSKGFG FVCFSSPEEATKAVTDMNGRIVGTKPLYVALAQRKEDRKAHLASQYMQRIANMRMQQIGPLFQPSGNGYFVPTIPPPQRFYGPTQMTQIRPHPRWSAQPQVRP | |||
Physicochemical properties | |||
| Number of amino acids: | 223 | ||
| Molecular weight: | 25,512.057 | ||
| Theoretical pI: | 9.864 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 15930 | ||
| Instability index: | 31.781 | ||
| aromaticity | 0.099 | ||
| GRAVY | -0.709 | ||
Secondary Structure Fraction | |||
| Helix | 0.256 | ||
| turn | 0.224 | ||
| sheet | 0.251 | ||