Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339469.1 | internal | 223 | 1-669(+) |
Amino Acid sequence : | |||
APLKVMFKDDGKSRGFGFVAFEESGAAERAVKELNGKEMFEGKPLYVGRAQKKAERQQELKRKFEQLKIERLSRYQGVNLYVKNLDDTIDDERLRKEFNLFGTITSAKVMMEEGRSKGFG FVCFSSPEEATKAVTDMNGRIVGTKPLYVALAQRKEDRKAHLASQYMQRIANMRMQQIGPLFQPSGNGYFVPTIPPPQRFYGPTQMTQIRPHPRWSAQPQVRP | |||
Physicochemical properties | |||
Number of amino acids: | 223 | ||
Molecular weight: | 25,512.057 | ||
Theoretical pI: | 9.864 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 15930 | ||
Instability index: | 31.781 | ||
aromaticity | 0.099 | ||
GRAVY | -0.709 | ||
Secondary Structure Fraction | |||
Helix | 0.256 | ||
turn | 0.224 | ||
sheet | 0.251 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339469.1 | internal | 223 | 1-669(+) |
Amino Acid sequence : | |||
APLKVMFKDDGKSRGFGFVAFEESGAAERAVKELNGKEMFEGKPLYVGRAQKKAERQQELKRKFEQLKIERLSRYQGVNLYVKNLDDTIDDERLRKEFNLFGTITSAKVMMEEGRSKGFG FVCFSSPEEATKAVTDMNGRIVGTKPLYVALAQRKEDRKAHLASQYMQRIANMRMQQIGPLFQPSGNGYFVPTIPPPQRFYGPTQMTQIRPHPRWSAQPQVRP | |||
Physicochemical properties | |||
Number of amino acids: | 223 | ||
Molecular weight: | 25,512.057 | ||
Theoretical pI: | 9.864 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 15930 | ||
Instability index: | 31.781 | ||
aromaticity | 0.099 | ||
GRAVY | -0.709 | ||
Secondary Structure Fraction | |||
Helix | 0.256 | ||
turn | 0.224 | ||
sheet | 0.251 |