Acc_NO	ORF type	length	start-end position (strand +/-)
>DY339470.1	5prime_partial	228	1-687(+)
Amino Acid sequence :
APVISLKFISTLLPFPFLLLHAATAIRFDIQNKCSYTIWPAVLPHGGGRRLDSGQTWTLSFQNGPKLAKVWARTNCTFDSSGKGKCLTGDCGGQLNCTTFGSPPHTKAEYGLNDFGRKDY YDVSVLDGYNLPMEMTPTANGCTRSVKCAAEDIVANCPSQLKVDGGCQNPCTVFKTTEYCCHAGECRPTDMSRFFKSRCRDAFTYPQDDPTSTFTCPESTSYRVVFCP*
Physicochemical properties
Number of amino acids:		228
Molecular weight:		13,331.600
Theoretical pI:		12.000
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		12490 12490
Instability index:		88.670
aromaticity		0.030
GRAVY		-0.631
Secondary Structure Fraction
Helix		0.090
turn		0.463
sheet		0.216

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY339470.1	5prime_partial	178	711-175(-)
Amino Acid sequence :
KKKNENKNLWAEDYPVASALRAGKSASGIILRVSKSVTATRFEETRHIRGPALSSVAAILRRFEHRARVLAAAVHLQLTGAIRHDVLRRALDGARAAVSRRRHLHRQIVAVQDGDVVVVL PPEVVEAVLRLGVRRRAEGGAVELAAAVAGEAFALAGGIKGAVGAGPDFGEFGAVLEG*
Physicochemical properties
Number of amino acids:		178
Molecular weight:		13,331.600
Theoretical pI:		12.000
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		12490 12490
Instability index:		88.670
aromaticity		0.030
GRAVY		-0.631
Secondary Structure Fraction
Helix		0.090
turn		0.463
sheet		0.216

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY339470.1	5prime_partial	134	2-406(+)
Amino Acid sequence :
HPLFLSNSSPLSSLSPSSSSTPPLPSASTSKTNAPTRSGRPSSPTAAAAASTAAKPGPYPSKTAPNSPKSGPAPTAPLIPPARANASPATAAASSTAPPSARRRTPRRSTASTTSGGRTT TTSPSWTATICRWR*
Physicochemical properties
Number of amino acids:		134
Molecular weight:		13,331.600
Theoretical pI:		12.000
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		12490 12490
Instability index:		88.670
aromaticity		0.030
GRAVY		-0.631
Secondary Structure Fraction
Helix		0.090
turn		0.463
sheet		0.216

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY339470.1	5prime_partial	228	1-687(+)
Amino Acid sequence :
APVISLKFISTLLPFPFLLLHAATAIRFDIQNKCSYTIWPAVLPHGGGRRLDSGQTWTLSFQNGPKLAKVWARTNCTFDSSGKGKCLTGDCGGQLNCTTFGSPPHTKAEYGLNDFGRKDY YDVSVLDGYNLPMEMTPTANGCTRSVKCAAEDIVANCPSQLKVDGGCQNPCTVFKTTEYCCHAGECRPTDMSRFFKSRCRDAFTYPQDDPTSTFTCPESTSYRVVFCP*
Physicochemical properties
Number of amino acids:		228
Molecular weight:		13,331.600
Theoretical pI:		12.000
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		12490 12490
Instability index:		88.670
aromaticity		0.030
GRAVY		-0.631
Secondary Structure Fraction
Helix		0.090
turn		0.463
sheet		0.216

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY339470.1	5prime_partial	178	711-175(-)
Amino Acid sequence :
KKKNENKNLWAEDYPVASALRAGKSASGIILRVSKSVTATRFEETRHIRGPALSSVAAILRRFEHRARVLAAAVHLQLTGAIRHDVLRRALDGARAAVSRRRHLHRQIVAVQDGDVVVVL PPEVVEAVLRLGVRRRAEGGAVELAAAVAGEAFALAGGIKGAVGAGPDFGEFGAVLEG*
Physicochemical properties
Number of amino acids:		178
Molecular weight:		13,331.600
Theoretical pI:		12.000
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		12490 12490
Instability index:		88.670
aromaticity		0.030
GRAVY		-0.631
Secondary Structure Fraction
Helix		0.090
turn		0.463
sheet		0.216

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY339470.1	5prime_partial	134	2-406(+)
Amino Acid sequence :
HPLFLSNSSPLSSLSPSSSSTPPLPSASTSKTNAPTRSGRPSSPTAAAAASTAAKPGPYPSKTAPNSPKSGPAPTAPLIPPARANASPATAAASSTAPPSARRRTPRRSTASTTSGGRTT TTSPSWTATICRWR*
Physicochemical properties
Number of amino acids:		134
Molecular weight:		13,331.600
Theoretical pI:		12.000
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		12490 12490
Instability index:		88.670
aromaticity		0.030
GRAVY		-0.631
Secondary Structure Fraction
Helix		0.090
turn		0.463
sheet		0.216