| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339470.1 | 5prime_partial | 228 | 1-687(+) |
Amino Acid sequence : | |||
| APVISLKFISTLLPFPFLLLHAATAIRFDIQNKCSYTIWPAVLPHGGGRRLDSGQTWTLSFQNGPKLAKVWARTNCTFDSSGKGKCLTGDCGGQLNCTTFGSPPHTKAEYGLNDFGRKDY YDVSVLDGYNLPMEMTPTANGCTRSVKCAAEDIVANCPSQLKVDGGCQNPCTVFKTTEYCCHAGECRPTDMSRFFKSRCRDAFTYPQDDPTSTFTCPESTSYRVVFCP* | |||
Physicochemical properties | |||
| Number of amino acids: | 228 | ||
| Molecular weight: | 13,331.600 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12490 | ||
| Instability index: | 88.670 | ||
| aromaticity | 0.030 | ||
| GRAVY | -0.631 | ||
Secondary Structure Fraction | |||
| Helix | 0.090 | ||
| turn | 0.463 | ||
| sheet | 0.216 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339470.1 | 5prime_partial | 178 | 711-175(-) |
Amino Acid sequence : | |||
| KKKNENKNLWAEDYPVASALRAGKSASGIILRVSKSVTATRFEETRHIRGPALSSVAAILRRFEHRARVLAAAVHLQLTGAIRHDVLRRALDGARAAVSRRRHLHRQIVAVQDGDVVVVL PPEVVEAVLRLGVRRRAEGGAVELAAAVAGEAFALAGGIKGAVGAGPDFGEFGAVLEG* | |||
Physicochemical properties | |||
| Number of amino acids: | 178 | ||
| Molecular weight: | 13,331.600 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12490 | ||
| Instability index: | 88.670 | ||
| aromaticity | 0.030 | ||
| GRAVY | -0.631 | ||
Secondary Structure Fraction | |||
| Helix | 0.090 | ||
| turn | 0.463 | ||
| sheet | 0.216 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339470.1 | 5prime_partial | 134 | 2-406(+) |
Amino Acid sequence : | |||
| HPLFLSNSSPLSSLSPSSSSTPPLPSASTSKTNAPTRSGRPSSPTAAAAASTAAKPGPYPSKTAPNSPKSGPAPTAPLIPPARANASPATAAASSTAPPSARRRTPRRSTASTTSGGRTT TTSPSWTATICRWR* | |||
Physicochemical properties | |||
| Number of amino acids: | 134 | ||
| Molecular weight: | 13,331.600 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12490 | ||
| Instability index: | 88.670 | ||
| aromaticity | 0.030 | ||
| GRAVY | -0.631 | ||
Secondary Structure Fraction | |||
| Helix | 0.090 | ||
| turn | 0.463 | ||
| sheet | 0.216 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339470.1 | 5prime_partial | 228 | 1-687(+) |
Amino Acid sequence : | |||
| APVISLKFISTLLPFPFLLLHAATAIRFDIQNKCSYTIWPAVLPHGGGRRLDSGQTWTLSFQNGPKLAKVWARTNCTFDSSGKGKCLTGDCGGQLNCTTFGSPPHTKAEYGLNDFGRKDY YDVSVLDGYNLPMEMTPTANGCTRSVKCAAEDIVANCPSQLKVDGGCQNPCTVFKTTEYCCHAGECRPTDMSRFFKSRCRDAFTYPQDDPTSTFTCPESTSYRVVFCP* | |||
Physicochemical properties | |||
| Number of amino acids: | 228 | ||
| Molecular weight: | 13,331.600 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12490 | ||
| Instability index: | 88.670 | ||
| aromaticity | 0.030 | ||
| GRAVY | -0.631 | ||
Secondary Structure Fraction | |||
| Helix | 0.090 | ||
| turn | 0.463 | ||
| sheet | 0.216 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339470.1 | 5prime_partial | 178 | 711-175(-) |
Amino Acid sequence : | |||
| KKKNENKNLWAEDYPVASALRAGKSASGIILRVSKSVTATRFEETRHIRGPALSSVAAILRRFEHRARVLAAAVHLQLTGAIRHDVLRRALDGARAAVSRRRHLHRQIVAVQDGDVVVVL PPEVVEAVLRLGVRRRAEGGAVELAAAVAGEAFALAGGIKGAVGAGPDFGEFGAVLEG* | |||
Physicochemical properties | |||
| Number of amino acids: | 178 | ||
| Molecular weight: | 13,331.600 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12490 | ||
| Instability index: | 88.670 | ||
| aromaticity | 0.030 | ||
| GRAVY | -0.631 | ||
Secondary Structure Fraction | |||
| Helix | 0.090 | ||
| turn | 0.463 | ||
| sheet | 0.216 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339470.1 | 5prime_partial | 134 | 2-406(+) |
Amino Acid sequence : | |||
| HPLFLSNSSPLSSLSPSSSSTPPLPSASTSKTNAPTRSGRPSSPTAAAAASTAAKPGPYPSKTAPNSPKSGPAPTAPLIPPARANASPATAAASSTAPPSARRRTPRRSTASTTSGGRTT TTSPSWTATICRWR* | |||
Physicochemical properties | |||
| Number of amino acids: | 134 | ||
| Molecular weight: | 13,331.600 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12490 | ||
| Instability index: | 88.670 | ||
| aromaticity | 0.030 | ||
| GRAVY | -0.631 | ||
Secondary Structure Fraction | |||
| Helix | 0.090 | ||
| turn | 0.463 | ||
| sheet | 0.216 | ||