| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339475.1 | internal | 205 | 2-616(+) |
Amino Acid sequence : | |||
| HPCCFDVGIAEQHAASFAAGLATEGLKPFCAIYSSFLQRGYDQVVHDVDLQKLPVRFMMDRAGLVGADGPTHCGAFDTTYMACLPNMVVMAPSDEAELMHMVATAAVIDDRPSCVRYPIG NGVGAALPFNNKGVPLEIGKGRILKEGSRVAILGFGTVVQNCLAAANLLQEHGISVSVADARFCKPLDGDLLKNLVKDHETLITV | |||
Physicochemical properties | |||
| Number of amino acids: | 205 | ||
| Molecular weight: | 21,813.007 | ||
| Theoretical pI: | 5.572 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6460 | ||
| Instability index: | 33.168 | ||
| aromaticity | 0.063 | ||
| GRAVY | 0.233 | ||
Secondary Structure Fraction | |||
| Helix | 0.302 | ||
| turn | 0.220 | ||
| sheet | 0.288 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339475.1 | internal | 205 | 2-616(+) |
Amino Acid sequence : | |||
| HPCCFDVGIAEQHAASFAAGLATEGLKPFCAIYSSFLQRGYDQVVHDVDLQKLPVRFMMDRAGLVGADGPTHCGAFDTTYMACLPNMVVMAPSDEAELMHMVATAAVIDDRPSCVRYPIG NGVGAALPFNNKGVPLEIGKGRILKEGSRVAILGFGTVVQNCLAAANLLQEHGISVSVADARFCKPLDGDLLKNLVKDHETLITV | |||
Physicochemical properties | |||
| Number of amino acids: | 205 | ||
| Molecular weight: | 21,813.007 | ||
| Theoretical pI: | 5.572 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6460 | ||
| Instability index: | 33.168 | ||
| aromaticity | 0.063 | ||
| GRAVY | 0.233 | ||
Secondary Structure Fraction | |||
| Helix | 0.302 | ||
| turn | 0.220 | ||
| sheet | 0.288 | ||