| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339481.1 | internal | 240 | 2-721(+) |
Amino Acid sequence : | |||
| HPFISMQFISCVQLPLPGMGLFRRRPPLSVRCSTDSSLPATVESSDFDAKVFRHNFMRRKDYNRKGFGHEEESLQRISRQYASENIIQKLRENGNEYRWGEVSVKLAEAYGLCWGVERAL RIAYEARKQFPTQNIWLTSEIIHNPTVNQRLREMGVNILPVKDGKKQFDLVGEGDVVVLSAFGAPVDEMVLLTQKKVEIVDTTCPWVSKVWHAVEKHKKGDYTSIIHGKYAHEETVTTAS | |||
Physicochemical properties | |||
| Number of amino acids: | 240 | ||
| Molecular weight: | 27,464.071 | ||
| Theoretical pI: | 8.826 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 37930 38180 | ||
| Instability index: | 50.011 | ||
| aromaticity | 0.092 | ||
| GRAVY | -0.439 | ||
Secondary Structure Fraction | |||
| Helix | 0.308 | ||
| turn | 0.217 | ||
| sheet | 0.225 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339481.1 | internal | 240 | 2-721(+) |
Amino Acid sequence : | |||
| HPFISMQFISCVQLPLPGMGLFRRRPPLSVRCSTDSSLPATVESSDFDAKVFRHNFMRRKDYNRKGFGHEEESLQRISRQYASENIIQKLRENGNEYRWGEVSVKLAEAYGLCWGVERAL RIAYEARKQFPTQNIWLTSEIIHNPTVNQRLREMGVNILPVKDGKKQFDLVGEGDVVVLSAFGAPVDEMVLLTQKKVEIVDTTCPWVSKVWHAVEKHKKGDYTSIIHGKYAHEETVTTAS | |||
Physicochemical properties | |||
| Number of amino acids: | 240 | ||
| Molecular weight: | 27,464.071 | ||
| Theoretical pI: | 8.826 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 37930 38180 | ||
| Instability index: | 50.011 | ||
| aromaticity | 0.092 | ||
| GRAVY | -0.439 | ||
Secondary Structure Fraction | |||
| Helix | 0.308 | ||
| turn | 0.217 | ||
| sheet | 0.225 | ||